awesome-repositories.com
Blog
MCP
awesome-repositories.com

Discover the best open-source repositories with AI-powered search.

ExploreCurated searchesOpen-source alternativesSelf-hosted softwareBlogSitemap
ProjectMCP serverAboutHow we rankPress
LegalPrivacyTerms
© 2026 Bringes Technology SRL·VAT RO45896025·hello@awesome-repositories.com
Back to ikew0ng/swipebacklayout

Projects sharing features with SwipeBackLayout

30 open-source projects similar to ikew0ng/swipebacklayout, ranked by shared indexed features. Tags may describe platforms or build tools rather than the same primary purpose. Check each project’s use case, license, and deployment requirements before treating it as a replacement.

  • issacw0ng/swipebacklayoutIssacw0ng avatar

    Issacw0ng/SwipeBackLayout

    6,089View on GitHub↗

    SwipeBackLayout is an Android gesture navigation library and view component designed to implement edge-swipe gestures for navigating back to previous screens. It provides the underlying logic and layout management necessary to integrate horizontal swipe transitions into an application's screen stack. The library utilizes a custom layout manager to coordinate the simultaneous movement of foreground and background views. It maps horizontal touch offsets to the translation and opacity of view hierarchies, using interpolation to calculate visual progression based on the swipe percentage. The sys

    Java
    View on GitHub↗6,089
  • mcxtzhang/swipedelmenulayoutmcxtzhang avatar

    mcxtzhang/SwipeDelMenuLayout

    3,791View on GitHub↗

    SwipeDelMenuLayout is an Android gesture interaction library that provides a swipe-to-reveal layout container. It allows developers to add slide-out action menus to list items by wrapping existing layouts in a specialized container without modifying the underlying view structure. The library includes a diagnostic performance monitor that hooks into the system display pipeline to detect frame drops and identify janky animations. It manages interaction coordination through velocity tracking and touch event interception to prevent conflicts between child menus and parent scrolling views. The co

    Javalistviewrecyclerviewsideslip-menu
    View on GitHub↗3,791
  • ibanimatable/ibanimatableIBAnimatable avatar

    IBAnimatable/IBAnimatable

    8,652View on GitHub↗

    IBAnimatable is a set of visual design tools for prototyping bespoke interface elements, motion effects, and navigation transitions within a graphical environment. It provides a designer for creating and prototyping animations directly within the Apple Interface Builder environment and a system for building custom interface components through a visual attributes panel. The project distinguishes itself by offering a visual interface transition editor for configuring screen navigation and gesture-driven transitions without manual coding. It includes a prototyping sandbox for testing interaction

    Swift
    View on GitHub↗8,652

AI search

Explore more awesome repositories

Describe what you need in plain English — the AI ranks thousands of curated open-source projects by relevance.

Find more with AI search
  • forkingdog/fdfullscreenpopgestureforkingdog avatar

    forkingdog/FDFullscreenPopGesture

    5,888View on GitHub↗

    FDFullscreenPopGesture is an iOS navigation gesture library and UIKit enhancement designed to implement edge-swipe back navigation and automatic navigation bar transitions in iOS applications. It provides a category for navigation controllers that adds a fullscreen swipe-to-pop gesture matching the system interaction style. The library manages the synchronization of navigation bar visibility animations during fullscreen transitions. This ensures that view controllers which do not natively support edge-swipe navigation can utilize system-standard back gestures. The project covers user interfa

    Objective-C
    View on GitHub↗5,888
  • bingoogolapple/bgarefreshlayout-androidbingoogolapple avatar

    bingoogolapple/BGARefreshLayout-Android

    4,287View on GitHub↗

    BGARefreshLayout-Android is a layout library for Android applications that implements pull-to-refresh and pull-up-to-load-more patterns. It serves as a specialized view container and list loading framework designed to manage loading indicators and status text during data fetching operations. The library distinguishes itself by supporting a customizable view hierarchy that allows for the integration of a dedicated advertisement space at the top of the layout, positioned above the scrollable content. It provides a view holder system that enables the creation of bespoke visual effects and animat

    Javarefreshlayout
    View on GitHub↗4,287
  • herotransitions/heroHeroTransitions avatar

    HeroTransitions/Hero

    22,462View on GitHub↗

    Hero is a transition framework and animation toolkit for iOS and tvOS designed to create fluid visual continuity between screens. It provides a shared element animation library that interpolates the position and size of views across different screens using unique identifiers. The framework includes an interactive transition controller that binds navigation progress to manual gestures and user input events in real time. It utilizes a system for calculating animation durations based on element distance and size to maintain a consistent sense of motion speed. The toolkit covers global coordinat

    Swift
    View on GitHub↗22,462
  • colineberhardt/vctransitionslibraryColinEberhardt avatar

    ColinEberhardt/VCTransitionsLibrary

    4,527View on GitHub↗

    VCTransitionsLibrary is a suite of tools providing pre-built visual effects and gesture-driven controllers for managing transitions between view controllers in iOS applications. It serves as a UIKit animation framework that implements custom animations for navigating between screens to improve visual flow. The library features a collection of pre-defined animations, including flip, fold, cube, and crossfade effects. It includes an interactive transition controller that links gesture recognizers, such as swipes and pinches, to animations, allowing users to manually drive or cancel the navigati

    Objective-C
    View on GitHub↗4,527
  • yalantis/kolodaYalantis avatar

    Yalantis/Koloda

    5,400View on GitHub↗

    Koloda is an iOS gesture interaction library and SwiftUI view component used to create swipeable card interfaces. It provides a stack-based view component that manages overlapping views, ensuring only the top-most element remains actively interactive. The library allows for the customization of card appearance, including the configuration of overlays and animations that dictate how background cards move during a swipe. It manages drag behavior and swipe directions, triggering specific logic when cards are swiped, tapped, or fully exhausted. The component covers the implementation of gesture-

    Swift
    View on GitHub↗5,400
  • marcosgriselli/viewanimatormarcosgriselli avatar

    marcosgriselli/ViewAnimator

    7,325View on GitHub↗

    ViewAnimator is a Swift animation library and view transition framework designed to coordinate visual motion effects across interface elements. It provides a motion engine that executes animation sequences and geometric transforms on individual views and layout cells. The framework is built around a standardized animation protocol, allowing developers to create and integrate custom movement and transition behaviors. This extensibility enables the creation of reusable animation libraries beyond the pre-defined effects. The system supports combining multiple visual transforms into single compo

    Swift
    View on GitHub↗7,325
  • software-mansion/react-native-gesture-handlersoftware-mansion avatar

    software-mansion/react-native-gesture-handler

    6,755View on GitHub↗

    React Native Gesture Handler is a declarative library that exposes the platform's native touch and gesture system to React Native, enabling smooth, deterministic gesture handling on the UI thread. It manages gesture recognition through a native state machine with defined transitions between states like BEGAN, ACTIVE, END, and CANCELLED, routing touch events through platform-native gesture recognizers on both iOS and Android. The library provides a comprehensive gesture composition framework that allows developers to combine multiple gestures into race, simultaneous, or exclusive sequences, co

    TypeScriptgesturejavascriptreact-native
    View on GitHub↗6,755
  • gcssloop/androidnoteGcsSloop avatar

    GcsSloop/AndroidNote

    9,332View on GitHub↗

    AndroidNote is a technical knowledge base and reference resource for Android development. It provides comprehensive guidance on application architecture, custom view development, and advanced graphics programming. The project is distinguished by its depth in visual implementation, covering pseudo-3D perspective projections via virtual cameras and complex 2D rendering using Bézier curves and PorterDuff color blending. It also provides detailed methodologies for app modularization and the management of internal libraries through private Maven repositories and JitPack. The reference surface ext

    Javaandroidandroid-studiocustom-view
    View on GitHub↗9,332
  • viewdeck/viewdeckV

    ViewDeck/ViewDeck

    5,268View on GitHub↗

    ViewDeck is a side menu management framework and gesture-based navigation library for iOS. It provides a system for coordinating the presentation, animation, and interaction logic of left and right side menus within a container view controller. The framework features a dynamic menu controller that allows for updating or removing active menu controllers at runtime to modify available navigation options. It includes a transition coordinator to manage custom motion and visual properties for sliding navigation panels. The library supports both programmatic menu control and gesture-based activati

    Objective-C
    View on GitHub↗5,268
  • willmcpo/body-scroll-lockwillmcpo avatar

    willmcpo/body-scroll-lock

    4,099View on GitHub↗

    body-scroll-lock is a DOM scroll locking library and cross-browser scroll controller. It provides utilities to disable page scrolling while maintaining scrollability for specific nested elements across different browsers and devices. The project functions as a layout shift prevention utility and a web UI modal scroll manager. It includes mechanisms to add padding to the body when scrollbars are removed to prevent horizontal flickering and content shifting. The library covers scroll management for mobile navigation and modal interactions, enabling specific containers to remain scrollable whil

    JavaScriptangularbody-scrollbody-scroll-lock
    View on GitHub↗4,099
  • ealeksandrov/eaintroviewealeksandrov avatar

    ealeksandrov/EAIntroView

    3,736View on GitHub↗

    EAIntroView is an onboarding UI library used to build sequential introduction and welcome screens. It functions as a customizable walkthrough and interactive tutorial framework for creating guided tours and step-by-step instructional guides. The library features a coordinate-based layout engine that defines UI element placement using coordinates and offsets mapped to individual pages. It includes an event-driven UI component that triggers specific logic and animations based on page transition and visibility events. The framework manages view navigation through a navigation-controlled introdu

    Objective-Cdemointroios
    View on GitHub↗3,736
  • nhaarman/listviewanimationsnhaarman avatar

    nhaarman/ListViewAnimations

    5,523View on GitHub↗

    ListViewAnimations is an Android list item motion framework and animation library designed to implement visual transitions and interactivity within list and grid views. It provides a toolset for managing item motion, specifically focusing on how elements appear, move, and transition within a user interface. The library enables complex interactive gestures, including swipe-to-dismiss and drag-and-drop reordering. It also supports the animated expansion of list items to reveal hidden content and applies visual effects such as fading and scaling as elements enter the screen. The framework cover

    Java
    View on GitHub↗5,523
  • pkluz/pkrevealcontrollerpkluz avatar

    pkluz/PKRevealController

    3,830View on GitHub↗

    PKRevealController is an iOS navigation framework and slide-over UI controller. It functions as a gesture-based interface library and hierarchical view controller manager that allows secondary screens to slide over a primary content area through touch interactions. The system organizes parent and child controllers into a layered navigation structure, translating touch input into coordinate offsets to animate transitions. It manages the width and positioning of side panels to control the available screen real estate. The framework provides capabilities for side panel layout management and vie

    Objective-C
    View on GitHub↗3,830
  • react-native-modal/react-native-modalreact-native-modal avatar

    react-native-modal/react-native-modal

    5,657View on GitHub↗

    This is a mobile UI overlay library for React Native that provides an animated modal component. It functions as a gesture-responsive interface element used to present supplementary content via overlay windows that support custom transitions and dynamic layout adjustments. The library features a dynamic layout observer that automatically resizes and repositions components during screen rotations or when the on-screen keyboard appears. It implements gesture-based navigation, allowing users to dismiss overlays through configured swipe gestures and backdrop interactions. The project covers anima

    TypeScriptandroidanimatedanimation
    View on GitHub↗5,657
  • daimajia/androidviewanimationsdaimajia avatar

    daimajia/AndroidViewAnimations

    12,446View on GitHub↗

    AndroidViewAnimations is an animation library and visual effects toolkit for Android applications. It provides a framework for implementing motion effects, such as bouncing, sliding, and rotating transitions, for views within Android layouts. The library features a collection of predefined motion presets and stylized transition effects. These include curated sequences for shaking and pulsing to guide user attention, as well as complex movements like hinging or rolling for interface entry and exit. The toolkit covers a wide range of visual effects, including linear slides, elastic bounces, tr

    Javaandroidanimationeasing-functions
    View on GitHub↗12,446
  • mengto/springMengTo avatar

    MengTo/Spring

    14,038View on GitHub↗

    Spring is a Swift animation library and iOS view animation framework. It provides a spring physics animation engine designed to generate realistic, organic motion for user interface movements. The framework utilizes a declarative animation interface, allowing developers to define animation properties and behaviors without writing complex imperative code. This includes a declarative animation workflow where motion is configured through visual storyboards. The system manages iOS UI animations and Swift view transitions, specifically automating how views appear and disappear through triggered a

    Swift
    View on GitHub↗14,038
  • emergetools/powEmergeTools avatar

    EmergeTools/Pow

    4,316View on GitHub↗

    Pow is a suite of specialized toolkits for SwiftUI that provides structured implementations for animations, particle systems, and multi-sensory user feedback. It includes a visual feedback framework, an animation library, and a dedicated particle system. The project provides a rendering context for particle effects that avoids clipping by parent view boundaries. It also includes a haptic and audio feedback kit designed to trigger physical vibrations and sound effects in response to state changes within a user interface. The library covers a range of interface enhancements, including 3D rotat

    Swiftanimationeffectsios
    View on GitHub↗4,316
  • brentvatne/react-native-scrollable-tab-viewbrentvatne avatar

    brentvatne/react-native-scrollable-tab-view

    6,944View on GitHub↗

    This project is a cross-platform mobile tab navigator for React Native. It provides a swipable tab interface and an animated view switcher that allows users to move between different content areas using horizontal swipe gestures. The system features a customizable tab bar component that can be styled or replaced with custom components to control the visual layout. It supports independent scroll state management, ensuring each individual page maintains its own vertical scroll position when switching views. The navigation framework handles tab transition control and adjacent page pre-rendering

    JavaScript
    View on GitHub↗6,944
  • nandorojo/motinandorojo avatar

    nandorojo/moti

    4,542View on GitHub↗

    Moti is a cross-platform animation framework and state-driven animation engine designed to create consistent visual transitions and motion effects across mobile and web platforms. It functions as a native-thread animation wrapper and library that leverages a shared-value system to synchronize state changes between the logic layer and the native rendering engine. The framework distinguishes itself through its layout transition tools and the ability to execute complex sequences and loops on the native thread to maintain high frame rates. It provides a system for orchestrating smooth entry and e

    TypeScript
    View on GitHub↗4,542
  • andkulikov/transitions-everywhereandkulikov avatar

    andkulikov/transitions-everywhere

    4,785View on GitHub↗

    Transitions Everywhere is an Android view animation library and UI transition framework. It serves as an extension to the Jetpack Transitions library, providing a toolkit for implementing motion and recoloring animations during element transitions. The library enables the creation of custom scale, translation, and rotation effects to manage visual state changes in mobile interfaces. It provides a set of additional animation effects built on top of the Android Jetpack framework to achieve a dynamic visual experience. The framework covers view transition customization and UI motion design, uti

    Java
    View on GitHub↗4,785
  • ftlabs/fastclickftlabs avatar

    ftlabs/fastclick

    18,534View on GitHub↗

    Fastclick is a JavaScript library and touch event optimization tool designed to remove the 300ms delay between a physical tap and a click event on mobile browsers. It functions as a lightweight DOM event handler middleware that manages touch-to-click timing to reduce input lag and improve the responsiveness of mobile web interfaces. The library provides granular control over touch latency removal, including a mechanism to exclude specific elements from this optimization. This allows certain user interface components to maintain native browser touch behavior via CSS class identifiers. The pro

    HTML
    View on GitHub↗18,534
  • h5bp/effeckt.cssh5bp avatar

    h5bp/Effeckt.css

    10,817View on GitHub↗

    Effeckt.css is a hardware-accelerated CSS animation library and UI transition framework. It provides a collection of styles designed to create smooth element entrances, exits, and attention-grabbing visual effects while preventing visual stuttering during interface transitions. The library focuses on high-performance animations using GPU-accelerated properties to ensure fluid movement. It enables the simulation of application navigation by sliding page views in and out of the viewport from specified directions. The framework covers a suite of visual capabilities, including directional entran

    CSS
    View on GitHub↗10,817
  • devlight/navigationtabbarDevlight avatar

    Devlight/NavigationTabBar

    4,928View on GitHub↗

    NavigationTabBar is a SwiftUI navigation component for iOS applications that provides a bottom menu for switching between primary application sections. It functions as an animated UI element that uses scale and movement effects to provide visual feedback during navigation. The component includes integrated notification badge elements that display pending counts or status updates on individual menu items. It also features a synchronization mechanism that links the active tab state with a swiping content area to ensure the navigation bar remains aligned with the visible page. The system manage

    Javaandroidbadgebar
    View on GitHub↗4,928
  • blivesta/animsitionblivesta avatar

    blivesta/animsition

    3,810View on GitHub↗

    Animsition is a CSS page transition library and frontend motion framework designed to create fluid visual effects, such as fades and zooms, between web pages. It functions as a DOM navigation animator that manages the timing and sequence of page removal and insertion to provide continuous movement between screens. The system operates as a page overlay animator, utilizing a coordinate-based slide controller to move covering elements across the screen in specific directions. These overlays mask background changes during transitions to maintain visual continuity. The framework leverages hardwar

    CSS
    View on GitHub↗3,810
  • bigskysoftware/htmxbigskysoftware avatar

    bigskysoftware/htmx

    48,210View on GitHub↗

    HTMX is a hypermedia-driven frontend library that enables the creation of dynamic, asynchronous web applications by extending standard HTML attributes. It functions as a declarative engine that intercepts browser events to trigger network requests, allowing developers to update specific regions of the document with server-rendered HTML fragments. By shifting the logic of UI composition to the server, it minimizes the need for complex client-side state management and imperative JavaScript. The library distinguishes itself through a progressive enhancement workflow that ensures web interfaces r

    JavaScripthateoashtmlhtmx
    View on GitHub↗48,210
  • dimsemenov/magnific-popupdimsemenov avatar

    dimsemenov/Magnific-Popup

    11,329View on GitHub↗

    Magnific-Popup is a JavaScript lightbox library and frontend UI component used to display images, videos, and remote HTML content within a responsive overlay window. It functions as a responsive media gallery, providing a dimmed background to focus viewing on specific content. The library distinguishes itself through its ability to fetch and render remote HTML via asynchronous AJAX requests and its support for thumbnail zoom transitions. It includes a gallery system that groups multiple media items with directional controls, progress counters, and background preloading of adjacent assets to e

    JavaScript
    View on GitHub↗11,329
  • lcodecorex/twinklingrefreshlayoutlcodecorex avatar

    lcodecorex/TwinklingRefreshLayout

    3,984View on GitHub↗

    TwinklingRefreshLayout is a pull-to-refresh layout for Android that provides a scrollable container for implementing refresh and load-more functionality. It acts as a view wrapper for components such as RecyclerView, ScrollView, and WebView to ensure consistent refreshing and loading behaviors across different scrollable views. The project distinguishes itself through an overscroll rebound component that creates an elastic bouncing animation when users scroll past layout boundaries. It includes a system for custom refresh indicators, allowing header and footer views to animate their visual st

    Java
    View on GitHub↗3,984