awesome-repositories.com
Blog
awesome-repositories.com

Découvrez les meilleurs dépôts open-source grâce à notre recherche par IA.

ExplorerRecherches sélectionnéesAlternatives open sourceLogiciels auto-hébergésBlogPlan du site
ProjetÀ proposNotre méthodologiePresseServeur MCP
Mentions légalesConfidentialitéConditions d'utilisation
© 2026 Bringes Technology SRL·VAT RO45896025·hello@awesome-repositories.com
·

2 dépôts

Awesome GitHub RepositoriesMulti-GPU Load Balancing

Strategies for distributing computational workloads across multiple graphics processing units.

Distinguishing note: Focuses on parallelizing image processing tasks across hardware.

Explore 2 awesome GitHub repositories matching devops & infrastructure · Multi-GPU Load Balancing. Refine with filters or upvote what's useful.

Awesome Multi-GPU Load Balancing GitHub Repositories

Trouvez les meilleurs dépôts grâce à l'IA.Nous recherchons les dépôts les plus pertinents grâce à l'IA.
  • iperov/deepfaceliveAvatar de iperov

    iperov/DeepFaceLive

    30,536Voir sur GitHub↗

    DeepFaceLive is a desktop application designed for real-time facial replacement and animation within live video streams. By utilizing deep learning models, the software performs high-speed identity mapping and facial feature analysis to transform video content as it is captured. The engine relies on GPU-accelerated inference to execute these complex image manipulation tasks at interactive frame rates. The application distinguishes itself through a modular video processing pipeline that chains specialized tasks to maintain high throughput and low latency. It features a virtual camera streaming

    Distributes computational tasks across multiple graphics cards to parallelize image processing.

    Pythondeepfakefaceswapmachine-learning
    Voir sur GitHub↗30,536
  • zhaochenyang20/awesome-ml-sys-tutorialAvatar de zhaochenyang20

    zhaochenyang20/Awesome-ML-SYS-Tutorial

    5,371Voir sur GitHub↗

    This project provides a comprehensive technical guide and framework for engineering large-scale machine learning systems. It covers the full lifecycle of model development, focusing on the infrastructure and computational principles required to build, train, and serve generative AI models across distributed GPU clusters. The repository distinguishes itself by offering deep-dive tutorials and implementation strategies for complex system challenges. It emphasizes high-performance architectural primitives, such as collective communication orchestration, distributed tensor sharding, and static gr

    Equalizes token counts across GPU ranks to prevent performance bottlenecks caused by uneven sequence lengths.

    Python
    Voir sur GitHub↗5,371
  1. Home
  2. DevOps & Infrastructure
  3. Multi-GPU Load Balancing