awesome-repositories.com
Blog
awesome-repositories.com

Discover the best open-source repositories with AI-powered search.

ExploreCurated searchesOpen-source alternativesSelf-hosted softwareBlogSitemap
ProjectAboutHow we rankPressMCP server
LegalPrivacyTerms
© 2026 Bringes Technology SRL·VAT RO45896025·hello@awesome-repositories.com
·
Back to sczhou/codeformer

Open-source alternatives to CodeFormer

30 open-source projects similar to sczhou/codeformer, ranked by how many features they have in common. Compare stars, activity and what each one does to find the best CodeFormer alternative.

  • spipm/depixelization_pocspipm avatar

    spipm/Depixelization_poc

    4,535View on GitHub↗

    This project is an AI upscaling framework and deep learning image restorer designed to estimate original source pixels from low-resolution inputs. It functions as a super-resolution reconstruction system that transforms pixelated images into high-resolution versions by restoring high-frequency details and sharpening edges. The system utilizes a convolutional neural network pipeline to analyze pixel data and perform digital image restoration. It employs pixel-shuffle upsampling to rearrange channel dimensions into spatial dimensions, which increases resolution while reducing checkerboard artif

    Python
    View on GitHub↗4,535
  • fanghua-yu/supirFanghua-Yu avatar

    Fanghua-Yu/SUPIR

    5,587View on GitHub↗

    SUPIR is an AI image upscaler and restoration system designed to remove artifacts and restore quality to real-world photographs. It functions as a diffusion-based image enhancer and restoration tool that uses large-scale model scaling to produce high-resolution results with photorealistic details. The system balances visual aesthetics with input fidelity, allowing for a trade-off between strict adherence to the original image and the overall visual appeal of the output. It leverages large-scale model inference to improve image clarity and maintain realistic details during the upscaling proces

    Python
    View on GitHub↗5,587
  • tencentarc/gfpganTencentARC avatar

    TencentARC/GFPGAN

    37,469View on GitHub↗

    GFPGAN is a generative face restoration model and Python-based image processing tool designed to restore low-resolution facial images. It utilizes generative adversarial networks to recover fine details and increase the clarity of degraded portraits. The system employs a generative facial prior to map degraded images to a high-quality manifold, enabling blind-face restoration without requiring knowledge of the specific degradation process. It utilizes a multi-stage workflow that includes face detection, alignment, and region-specific masking to separate facial areas from the background. Beyo

    Pythondeep-learningface-restorationgan
    View on GitHub↗37,469

AI search

Explore more awesome repositories

Describe what you need in plain English — the AI ranks thousands of curated open-source projects by relevance.

Find more with AI search
  • ali-vilab/vaceali-vilab avatar

    ali-vilab/VACE

    3,645View on GitHub↗

    VACE is a set of software tools and frameworks for reference-guided video generation, diffusion-based editing, and video-to-video translation. It provides utilities to produce new video content and modify existing sequences by using reference materials to guide visual style, subject matter, and composition. The framework enables video-to-video translation and synthesis, allowing for the update of visual styles and depth. It also functions as a video editor for modifying properties and content through reference-guided transformations. The system covers localized video editing and inpainting,

    Pythonvideo-editingvideo-generation
    View on GitHub↗3,645
  • comfyanonymous/comfyuicomfyanonymous avatar

    comfyanonymous/ComfyUI

    117,322View on GitHub↗

    ComfyUI is a modular generative AI workflow orchestrator and node-based GUI for designing and executing complex diffusion model pipelines. It functions as both a visual interface for building generative logic graphs and a programmable backend API that exposes diffusion model operations for external integration. The system distinguishes itself through a graph-based execution model that supports differential workflow execution, re-running only modified nodes to reduce computation. It features dynamic model offloading to manage memory between system RAM and GPU VRAM and utilizes metadata-embedde

    Python
    View on GitHub↗117,322
  • nvlabs/styleganNVlabs avatar

    NVlabs/stylegan

    14,412View on GitHub↗

    StyleGAN is a TensorFlow-based generative adversarial network framework designed for the synthesis of high-resolution synthetic imagery. It utilizes a style-based generator architecture to create realistic visual assets from latent vectors, focusing on the production of high-fidelity images. The system incorporates style mixing and stochastic noise injection to control visual attributes and fine-grained details. It uses adaptive instance normalization and progressive resolution upsampling to manage image quality and variety across different resolutions. The framework covers the full lifecycl

    Python
    View on GitHub↗14,412
  • jantic/deoldifyjantic avatar

    jantic/DeOldify

    18,487View on GitHub↗

    DeOldify is a deep learning system and a set of pre-trained computer vision models designed to apply realistic colors to grayscale photographs and video footage. It functions as a neural media restoration tool that uses trained networks to estimate original hues for black-and-white media and remove glitches and artifacts from aged images and film. The project employs a NoGAN colorization technique that removes the GAN discriminator during training to prevent artifacts and avoid over-saturation of pixels. For cinematic sequences, it applies temporal frame consistency to maintain color stabilit

    Python
    View on GitHub↗18,487
  • cs231n/cs231n.github.iocs231n avatar

    cs231n/cs231n.github.io

    10,923View on GitHub↗

    This project is a static educational website and comprehensive curriculum focused on computer vision and deep learning. It serves as a public repository of instructional materials, lecture notes, and technical guides specifically detailing convolutional neural networks and visual recognition. The site is developed using static-site generation to host course documentation and student project directories. It provides structured academic resources that guide learners through image classification, generative modeling, and the implementation of various neural network architectures. The curriculum

    Jupyter Notebook
    View on GitHub↗10,923
  • hannahmitt/homemirrorHannahMitt avatar

    HannahMitt/HomeMirror

    7,811View on GitHub↗

    HomeMirror is an Android application designed to turn a tablet or screen into a smart mirror and personal information dashboard. It provides a specialized user interface for wall-mounted displays that integrates external data providers with personal scheduling. The system includes a vision-based facial expression analysis tool that detects a user's mood through camera input to adjust the visual display of the information dashboard. The application aggregates real-time data including weather, calendar events, and financial stock price fluctuations. It also tracks personal reminders such as da

    Java
    View on GitHub↗7,811
  • paddlepaddle/paddleganPaddlePaddle avatar

    PaddlePaddle/PaddleGAN

    8,043View on GitHub↗

    PaddleGAN is a generative AI framework and deep learning computer vision library built on the PaddlePaddle framework. It serves as a toolkit for image and video synthesis, providing a collection of generative adversarial network implementations for creating synthetic visual content. The library focuses on advanced synthesis capabilities, including the generation of talking heads through lip motion synchronization and the creation of synthetic videos via motion transfer from driving sequences. It provides tools for domain-to-domain translation, allowing for image style transfer and the transfo

    Pythonanimeganv2basicvsrpluspluscyclegan
    View on GitHub↗8,043
  • dmitryulyanov/deep-image-priorDmitryUlyanov avatar

    DmitryUlyanov/deep-image-prior

    8,085View on GitHub↗

    This project is an unsupervised image restoration tool that uses a convolutional neural network as a structural prior to reconstruct images from noisy or incomplete data. It functions as a neural network image prior, utilizing the inherent biases of the network architecture to restore pixels without the need for a pre-trained dataset or external learning. The system performs zero-shot image restoration by treating the network architecture itself as a regularization term. It uses a randomly initialized encoder-decoder structure and iterative gradient descent to minimize pixel-wise loss, recove

    Jupyter Notebook
    View on GitHub↗8,085
  • xpixelgroup/basicsrXPixelGroup avatar

    XPixelGroup/BasicSR

    8,297View on GitHub↗

    BasicSR is a PyTorch-based image restoration toolbox and framework designed for training and deploying deep learning models to upscale, denoise, and deblur images and videos. It serves as a comprehensive system for image super-resolution and video quality restoration, providing the necessary infrastructure to recover fine visual details and increase pixel density. The project distinguishes itself through specialized toolkits for facial image enhancement and high-fidelity face synthesis, as well as a dedicated video quality restoration suite that utilizes deformable convolutions and generative

    Pythonbasicsrbasicvsrdfdnet
    View on GitHub↗8,297
  • open-mmlab/mmagicopen-mmlab avatar

    open-mmlab/mmagic

    7,434View on GitHub↗

    mmagic is a multimodal training pipeline and framework for generative AI, focusing on visual synthesis and restoration. It provides the infrastructure to build and train models for tasks such as text-to-image and text-to-video generation, 3D-aware content synthesis, and high-fidelity image translation using diffusion models and generative adversarial networks. The project distinguishes itself through specialized capabilities for generative model personalization, including techniques for fine-tuning subjects and styles. It also supports advanced visual manipulations such as latent space interp

    Jupyter Notebookaigccomputer-visiondeep-learning
    View on GitHub↗7,434
  • advimman/lamaadvimman avatar

    advimman/lama

    10,056View on GitHub↗

    Lama is an image restoration framework and deep learning model designed for image inpainting and object removal. It provides the tools necessary to train and evaluate neural networks that fill masked areas and repair corrupted visual data. The system utilizes a Fourier convolution neural network to maintain global image structure and reconstruct periodic patterns. This architecture allows for resolution-independent inference, enabling the processing of high-resolution images without increasing memory or computational requirements. The project includes a synthetic dataset generator that creat

    Jupyter Notebookcnncolabcolab-notebook
    View on GitHub↗10,056
  • ladaapp/ladaladaapp avatar

    ladaapp/lada

    3,402View on GitHub↗
    Pythondepixelizationjav-restorationmosaic-removal
    View on GitHub↗3,402
  • nagadomi/waifu2xnagadomi avatar

    nagadomi/waifu2x

    28,144View on GitHub↗

    This project is a command-line tool designed for image super-resolution and noise reduction, with a primary focus on anime-style illustrations. It utilizes convolutional neural network inference to reconstruct missing pixel data and remove digital artifacts, allowing users to upscale images and reduce noise either independently or in a single simultaneous processing pass. Beyond its core image restoration capabilities, the software provides a comprehensive suite for machine learning model training. Users can prepare custom datasets and optimize neural networks for specific restoration tasks,

    Luasuper-resolutiontorchwaifu2x
    View on GitHub↗28,144
  • iperov/deepfaceliveiperov avatar

    iperov/DeepFaceLive

    30,536View on GitHub↗

    DeepFaceLive is a desktop application designed for real-time facial replacement and animation within live video streams. By utilizing deep learning models, the software performs high-speed identity mapping and facial feature analysis to transform video content as it is captured. The engine relies on GPU-accelerated inference to execute these complex image manipulation tasks at interactive frame rates. The application distinguishes itself through a modular video processing pipeline that chains specialized tasks to maintain high throughput and low latency. It features a virtual camera streaming

    Pythondeepfakefaceswapmachine-learning
    View on GitHub↗30,536
  • aaronfeng753/waifu2x-extension-guiAaronFeng753 avatar

    AaronFeng753/Waifu2x-Extension-GUI

    16,146View on GitHub↗

    Waifu2x-Extension-GUI is a desktop application designed for high-fidelity media restoration and enhancement. It functions as a graphical interface that orchestrates specialized deep learning engines to upscale, denoise, and interpolate images and videos, improving visual clarity and motion smoothness. The software distinguishes itself through its ability to manage complex, automated media processing pipelines. Users can chain multiple tasks—such as format conversion, scene detection, and frame rate interpolation—into sequential workflows that execute without manual intervention. It provides g

    C++animeanime4kesrgan
    View on GitHub↗16,146
  • k4yt3x/video2xk4yt3x avatar

    k4yt3x/video2x

    18,754View on GitHub↗

    Video2x is a modular processing framework designed for AI-enhanced video upscaling and frame rate conversion. It functions as a comprehensive toolset for increasing the resolution and visual clarity of media files while generating intermediate frames to improve motion smoothness. The system is built to handle intensive media transformation tasks by leveraging hardware acceleration and custom encoding pipelines. The project distinguishes itself through a plugin-based architecture that allows for the integration of custom machine learning models and specialized algorithms. It utilizes a modular

    C++anime4kframe-interpolationmachine-learning
    View on GitHub↗18,754
  • lxfater/inpaint-weblxfater avatar

    lxfater/inpaint-web

    5,834View on GitHub↗

    A free and open-source inpainting & image-upscaling tool powered by webgpu and wasm on the browser。| 基于 Webgpu 技术和 wasm 技术的免费开源 inpainting & image-upscaling 工具, 纯浏览器端实现。

    TypeScriptimage-upscalinginpaintingsuper-resolution
    View on GitHub↗5,834
  • hlky/stable-diffusion-webuihlky avatar

    hlky/stable-diffusion-webui

    7,880View on GitHub↗

    Stable Diffusion Web UI is a browser-based interface for generating, editing, and upscaling images and videos using latent diffusion models. It functions as a text-to-image generator, an AI image editor, and a tool for increasing image resolution and clarity. The system includes capabilities for custom model training, specifically allowing the creation of textual inversion embeddings to teach a model new concepts and visual styles from user photos. It also provides tools for AI video production, generating short clips from text prompts. The software covers image-to-image transformation, imag

    Python
    View on GitHub↗7,880
  • chainner-org/chainnerchaiNNer-org avatar

    chaiNNer-org/chaiNNer

    5,855View on GitHub↗

    chaiNNer is a GPU-accelerated AI image upscaling application that uses a visual node-based interface for constructing image processing pipelines. At its core, it provides a node-based visual programming environment where users connect processing nodes in a directed acyclic graph, with a graph execution scheduler that traverses the pipeline in topological order. The application includes an iterator-based batch processing system that automatically applies the same pipeline to multiple files, and a model format conversion pipeline that transforms neural network models between PyTorch, ONNX, and N

    Python
    View on GitHub↗5,855
  • eutropicai/final2xEutropicAI avatar

    EutropicAI/Final2x

    7,207View on GitHub↗

    Final2x is an AI image super-resolution tool and neural network inference engine designed to increase image resolution and reconstruct missing details while reducing noise. It functions as a cross-platform image upscaler that executes consistent super-resolution logic across different operating systems. The project serves as a custom model inference engine and upscaling interface, allowing for the import and application of user-defined super-resolution weights and architectures to tailor the visual output of enlarged images. The system utilizes hardware-accelerated processing to offload comp

    TypeScriptcomputer-visioncross-platformelectron
    View on GitHub↗7,207
  • sanster/iopaintSanster avatar

    Sanster/IOPaint

    23,244View on GitHub↗

    IOPaint is an AI image editor and Stable Diffusion inpainting tool providing a web interface for removing objects and replacing image content. It utilizes latent diffusion image processing to synthesize high-resolution replacements for erased sections of an image. The project features a specialized AI background remover for isolating subjects and an AI image upscaler that employs super-resolution models for general photos and anime artwork. The software covers a broad range of capabilities including image segmentation for object isolation, face restoration for improving facial details, and t

    Pythoninpaintinglamalatent-diffusion
    View on GitHub↗23,244
  • djdefrag/qualityscalerDjdefrag avatar

    Djdefrag/QualityScaler

    2,970View on GitHub↗

    QualityScaler is an AI video upscaler and local media processing tool designed to increase the resolution and visual quality of videos and images. It uses deep learning models to enhance detail and remove noise, operating as an offline application that executes all computations on local hardware. The project functions as a GPU-accelerated media processor that distributes workloads across multiple graphics cards to increase rendering speed. To prevent memory overflow during high-resolution tasks, it employs a tiled image processing method that splits large assets into smaller sections. The sy

    Pythonamdanimecompression-artifact-reduction
    View on GitHub↗2,970
  • philz1337x/clarity-upscalerphilz1337x avatar

    philz1337x/clarity-upscaler

    5,079View on GitHub↗

    Clarity-upscaler is an AI image upscaler and enhancement tool that uses deep learning models to increase image resolution and restore visual detail. It functions as a super-resolution inference engine that employs neural networks to predict missing pixels and synthesize high-frequency details from low-resolution sources. The project is delivered as a programmable API, allowing the integration of automated high-resolution image processing and sharpening into external applications and workflows. This interface enables the programmatic upscaling of images to create high-resolution assets. The s

    Pythonaiai-artimage-upscale
    View on GitHub↗5,079
  • janspiry/image-super-resolution-via-iterative-refinementJanspiry avatar

    Janspiry/Image-Super-Resolution-via-Iterative-Refinement

    3,920View on GitHub↗

    This project is a deep learning framework for AI image super-resolution and facial synthesis. It provides a diffusion model image upscaler and a generative facial image synthesizer capable of transforming low-resolution images into high-resolution outputs using pretrained model weights. The system utilizes iterative diffusion refinement and low-resolution guided sampling to restore fine details and sharpness. It supports both unconditional image generation, where images are created from scratch, and guided resolution enhancement for high-fidelity facial reconstruction. The repository include

    Python
    View on GitHub↗3,920
  • nihui/waifu2x-ncnn-vulkannihui avatar

    nihui/waifu2x-ncnn-vulkan

    3,326View on GitHub↗

    waifu2x-ncnn-vulkan is an AI super-resolution tool and image processor that uses deep learning to increase image resolution and remove visual noise. It is an NCNN-based implementation designed for efficient neural network inference on local hardware. The project utilizes the Vulkan API to provide GPU-accelerated image scaling and noise reduction across diverse graphics hardware. It employs tiled image processing to prevent GPU memory overflow and multi-threaded model loading to reduce initial startup latency. The software covers functional domains including AI image upscaling for maintaining

    C++amdgpuintel
    View on GitHub↗3,326
  • xinntao/esrganxinntao avatar

    xinntao/ESRGAN

    6,556View on GitHub↗

    ESRGAN is a deep learning image restoration framework designed for image super-resolution. It uses a generative adversarial network system to upscale low-resolution images into high-quality versions with sharp visual details and recovered fine textures. The framework implements a perceptual super-resolution model that optimizes the trade-off between perceived visual quality and pixel-level signal-to-noise ratio. It includes weight-interpolation blending to allow for the adjustment of visual sharpness and signal-to-noise ratios by mixing weights from different trained models. The system cover

    Python
    View on GitHub↗6,556
  • xxxily/h5playerxxxily avatar

    xxxily/h5player

    3,575View on GitHub↗

    h5player is an HTML5 video player extension and web media controller that adds advanced playback controls, visual filters, and media downloading capabilities to any web page using the HTML5 video tag. It functions as a customizable media hotkey manager and real-time video filter tool to enhance the standard browser viewing experience. The project is distinguished by its configuration-driven extension system, which allows for the remapping of playback shortcuts and the addition of new features through external scripts. It also provides a real-time visual filtering suite for modifying brightnes

    JavaScriptchrome-extensionh5playerplayer
    View on GitHub↗3,575