awesome-repositories.com
Blog
MCP
awesome-repositories.com

Discover the best open-source repositories with AI-powered search.

ExploreCurated searchesOpen-source alternativesSelf-hosted softwareBlogSitemap
ProjectMCP serverAboutHow we rankPress
LegalPrivacyTerms
© 2026 Bringes Technology SRL·VAT RO45896025·hello@awesome-repositories.com
·
Back to alloyteam/alloyfinger

Open-source alternatives to AlloyFinger

30 open-source projects similar to alloyteam/alloyfinger, ranked by how many features they have in common. Compare stars, activity and what each one does to find the best AlloyFinger alternative.

  • yalantis/phoenixYalantis avatar

    Yalantis/Phoenix

    3,975View on GitHub↗

    Phoenix is a JavaScript gesture library and mobile-first interaction toolset designed to manage touch events and scroll behaviors in web-based interfaces. Its primary purpose is to provide a pull-to-refresh UI component that triggers data updates when a user pulls down on a mobile or web view. The library focuses on mobile web interaction design, providing themed animations and visual indicators that mimic native mobile app gestures. It enables the implementation of dynamic data refresh workflows through a downward drag interaction. The project covers the interception of scroll events and th

    Javaandroidanimationjava
    View on GitHub↗3,975
  • mcxtzhang/swipedelmenulayoutmcxtzhang avatar

    mcxtzhang/SwipeDelMenuLayout

    3,791View on GitHub↗

    SwipeDelMenuLayout is an Android gesture interaction library that provides a swipe-to-reveal layout container. It allows developers to add slide-out action menus to list items by wrapping existing layouts in a specialized container without modifying the underlying view structure. The library includes a diagnostic performance monitor that hooks into the system display pipeline to detect frame drops and identify janky animations. It manages interaction coordination through velocity tracking and touch event interception to prevent conflicts between child menus and parent scrolling views. The co

    Javalistviewrecyclerviewsideslip-menu
    View on GitHub↗3,791
  • aholachek/mobile-first-animationaholachek avatar

    aholachek/mobile-first-animation

    2,072View on GitHub↗

    Mobile-first-animation is a mobile web animation library and touch gesture animation toolkit designed to create fluid, gesture-driven animations and spring physics interactions. It provides a spring physics simulation engine that calculates realistic motion dynamics, responding naturally to user velocity and release points. The library features a gesture-driven animation pipeline that binds raw touch input directly to animation drivers, alongside a declarative animation interpolation system that maps continuous touch coordinate ranges to visual style properties. It applies hardware-accelerate

    JavaScriptanimationgesturesmobile-first
    View on GitHub↗2,072

AI search

Explore more awesome repositories

Describe what you need in plain English — the AI ranks thousands of curated open-source projects by relevance.

Find more with AI search
  • ustbhuangyi/better-scrollustbhuangyi avatar

    ustbhuangyi/better-scroll

    16,489View on GitHub↗

    Better-scroll is a JavaScript scroll library and touch interaction engine designed to create high-performance scrollable areas in web browsers. It functions as a modular UI component framework that provides the foundation for building complex scrollable elements. The library is distinguished by a plugin-based architecture that allows the injection of custom methods and event hooks. This system enables the creation of specialized interface components such as carousel sliders, scrollable picker inputs, and draggable element systems. The project covers a wide range of mobile web interaction pat

    TypeScriptbetter-performanceiosiscroll
    View on GitHub↗16,489
  • mcasimir/mobile-angular-uimcasimir avatar

    mcasimir/mobile-angular-ui

    2,846View on GitHub↗

    Mobile-angular-ui is a frontend framework designed for building touch-friendly mobile web applications using AngularJS and Bootstrap styles. It provides a toolkit for creating cross-platform interfaces with native-like gestures and responsive layouts, enabling developers to transform standard desktop web interfaces into touch-friendly mobile layouts with minimal structural adaptations. The framework includes directive-driven UI components such as sidebars, overlays, switches, and navigation bars. It supports declarative state management through generic directives that bind state transformatio

    JavaScript
    View on GitHub↗2,846
  • lyfeyaj/swipelyfeyaj avatar

    lyfeyaj/swipe

    962View on GitHub↗

    Swipe is a touch-responsive slider library designed to create interactive content carousels for web applications. It provides a framework-agnostic core engine that manages state, animation loops, and input normalization, allowing for the display of content sequences with support for manual swiping and automated transitions. The library distinguishes itself through a decoupled architecture that separates its core slider logic from UI-specific bindings. This design enables the use of specialized adapters for integration into component-based environments, including dedicated support for React an

    JavaScriptangularmobilereact
    View on GitHub↗962
  • kando-menu/kandokando-menu avatar

    kando-menu/kando

    5,618View on GitHub↗

    Kando is a cross-platform desktop pie menu launcher that runs on Windows, macOS, and Linux, including Wayland compositors. It opens a radial menu on a hotkey and lets users select applications, files, or shortcuts by moving the cursor toward a slice, and can also be controlled from the command line to open specific menus or trigger shortcuts. The project distinguishes itself through a gesture-based selection system that interprets pointer movement direction and distance rather than requiring precise clicking, and an input device abstraction layer that normalizes input from mouse, stylus, touc

    TypeScriptcross-platformelectrongestures
    View on GitHub↗5,618
  • urho3d/urho3durho3d avatar

    urho3d/urho3d

    4,707View on GitHub↗

    Urho3D is a cross-platform 3D game engine written in C++. It uses a component-based scene graph to compose game objects from nodes and attached components, separating transforms from behaviors for modular design. The engine integrates AngelScript and Lua scripting for game logic, uses the Bullet library for physics simulation, and renders scenes with OpenGL or Direct3D through forward, deferred, or light pre-pass pipelines with customizable render passes and shadow mapping. The engine distinguishes itself with a built-in visual scene and UI editor for composing 3D worlds and interface layouts

    C++2d3d3d-graphics
    View on GitHub↗4,707
  • daneden/animate.cssdaneden avatar

    daneden/animate.css

    82,613View on GitHub↗

    Animate.css is a CSS animation library and browser-based motion framework. It provides a collection of pre-made animations and motion effects used to add visual movement to web elements across different browsers. The library is designed as an accessibility-aware system that automatically disables animations when the operating system has a reduce motion setting enabled. This ensures that web motion respects user preferences for accessibility. The framework covers front-end visual effects and cross-browser UI styling. It utilizes a utility-first architecture with predefined style classes to ma

    CSS
    View on GitHub↗82,613
  • elrumordelaluz/csshakeelrumordelaluz avatar

    elrumordelaluz/csshake

    4,881View on GitHub↗

    csshake is a CSS animation library and framework designed to create shaking, vibrating, and oscillating movement effects on DOM elements. It functions as a UI feedback component that uses visual motion patterns to signal errors or draw user attention through irregular element movement. The library provides multi-axis shake effects, including horizontal, vertical, and rotational motion patterns. These are implemented through class-based triggering mechanisms that allow for the delivery of error-signaling patterns and other attention-grabbing effects. The system covers a range of animation con

    SCSSanimationcsscsshake
    View on GitHub↗4,881
  • gdsmith/jquery.easinggdsmith avatar

    gdsmith/jquery.easing

    918View on GitHub↗

    jQuery Easing Plugin

    JavaScript
    View on GitHub↗918
  • gudh/ihovergudh avatar

    gudh/ihover

    3,463View on GitHub↗

    iHover is a collection of hover effects using pure CSS, inspired by codrops article, powered by Sass.

    Pug
    View on GitHub↗3,463
  • h5bp/effeckt.cssh5bp avatar

    h5bp/Effeckt.css

    10,817View on GitHub↗

    Effeckt.css is a hardware-accelerated CSS animation library and UI transition framework. It provides a collection of styles designed to create smooth element entrances, exits, and attention-grabbing visual effects while preventing visual stuttering during interface transitions. The library focuses on high-performance animations using GPU-accelerated properties to ensure fluid movement. It enables the simulation of application navigation by sliding page views in and out of the viewport from specified directions. The framework covers a suite of visual capabilities, including directional entran

    CSS
    View on GitHub↗10,817
  • hakimel/stroll.jshakimel avatar

    hakimel/stroll.js

    4,342View on GitHub↗

    stroll.js is a frontend UI animation library designed to transform standard web lists into three-dimensional scrolling displays. It functions as a tool for creating depth-based perspectives using CSS3 transforms. The library specializes in 3D web animations and interactive list design. It implements visual effects that respond to user movement, adding spatial depth and perspective to list elements as they are navigated.

    HTML
    View on GitHub↗4,342
  • hasinhayder/imagecaptionhoveranimationH

    hasinhayder/ImageCaptionHoverAnimation

    0View on GitHub↗
    View on GitHub↗0
  • hubspot/odometerHubSpot avatar

    HubSpot/odometer

    7,298View on GitHub↗

    Odometer is a JavaScript number animation library and frontend UI tool designed to create fluid counting effects. It functions as a numerical transition component that updates numbers on a page using animated rolling or sliding transitions. The library focuses on numerical value animation and data transition effects, allowing users to transition smoothly between two numerical values. This is used for updating metrics and key performance indicators in dynamic dashboard visualizations to avoid abrupt jumps in data displays.

    CSS
    View on GitHub↗7,298
  • ianlunn/hoverIanLunn avatar

    IanLunn/Hover

    29,393View on GitHub↗

    Hover is a collection of pre-defined CSS3 animations and reusable stylesheets for links, buttons, and images. It serves as a web UI animation kit and a library of styles written in CSS, Sass, and LESS to provide visual feedback when a user hovers over an element. The library includes specialized interactive effects that simulate tactile behaviors, such as page curls and the rendering of speech bubbles. It also provides a set of animation primitives to manipulate backgrounds, borders, shadows, and glow effects to simulate depth and elevation. The project covers a wide range of element motion

    SCSScsscss-effectssass
    View on GitHub↗29,393
  • juliangarnier/animejuliangarnier avatar

    juliangarnier/anime

    69,932View on GitHub↗

    This project is a declarative motion framework and JavaScript animation engine designed to transition CSS properties, SVG attributes, and DOM elements. It provides a comprehensive set of tools for creating complex, multi-part motion sequences by synchronizing animations, timers, and callbacks into a single, unified timeline. The library distinguishes itself through a robust timeline-based sequence orchestrator that allows for precise timing, label-based control, and hierarchical nesting of animations. It also features a physics-driven interaction library that enables draggable elements with c

    JavaScriptanimationanimecanvas
    View on GitHub↗69,932
  • julianlloyd/scrollreveal.jsJ

    julianlloyd/scrollReveal.js

    0View on GitHub↗
    View on GitHub↗0
  • julianshapiro/blastjulianshapiro avatar

    julianshapiro/blast

    1,522View on GitHub↗

    Blast text apart to make it manipulable.

    JavaScript
    View on GitHub↗1,522
  • julianshapiro/velocityjulianshapiro avatar

    julianshapiro/velocity

    17,217View on GitHub↗

    Velocity is a JavaScript animation library used to create high-performance CSS and SVG animations. It functions as a CSS property interpolator and a spring physics engine, enabling the creation of smooth visual transitions and organic movement for web elements. The project provides a programmatic interface for modifying vector attributes and 3D transformations through its SVG animation framework. It further distinguishes itself as an animation sequence orchestrator, allowing for the chaining of movements and the staggering of start times across multiple elements using promises. The library c

    JavaScript
    View on GitHub↗17,217
  • matthieua/wowmatthieua avatar

    matthieua/WOW

    9,903View on GitHub↗

    WOW is a JavaScript library and frontend animation controller that triggers CSS animations when elements enter the browser viewport during scrolling. It functions as a viewport trigger engine, managing the timing and execution of visual transitions for both static and dynamic page content. The library integrates scroll events with CSS animations and effects from libraries such as Animate.css. It utilizes intersection observers to monitor viewport entry and mutation observers to track and apply animation triggers to new elements added to the DOM after the initial setup.

    JavaScript
    View on GitHub↗9,903
  • minimac/magicminiMAC avatar

    miniMAC/magic

    8,601View on GitHub↗

    Magic is a CSS animation library and visual effects framework providing a collection of predefined motion styles for moving, rotating, and transforming web elements. It serves as a build-time CSS optimizer that compiles only the specific animation styles used in a project to minimize the final stylesheet size. The framework enables interactive user interface development by allowing animations to be triggered programmatically through scripts, hover events, or timing delays. It utilizes a system of timing and motion classes to manage the duration and speed of visual transitions. The project co

    SCSS
    View on GitHub↗8,601
  • nckprsn/scrollmenckprsn avatar

    nckprsn/scrollme

    1,454View on GitHub↗

    A jQuery plugin for adding simple scrolling effects to web pages.

    JavaScript
    View on GitHub↗1,454
  • oliviertassinari/react-swipeable-viewsoliviertassinari avatar

    oliviertassinari/react-swipeable-views

    4,473View on GitHub↗

    This project is a React library for creating touch-enabled sliding views and interactive view switchers. It provides components for building content carousels and sliders that support horizontal or vertical navigation via touch, mouse swipe gestures, and keyboard inputs. The library includes a virtualized slider component that renders only visible views to maintain performance with large content sets. It supports specialized visual behaviors such as three-dimensional coverflow transitions, circular navigation for infinite looping, and edge resistance effects when reaching the boundaries of a

    JavaScript
    View on GitHub↗4,473
  • peachananr/interactive_3dP

    peachananr/interactive_3d

    0View on GitHub↗
    View on GitHub↗0
  • ramswaroop/animatescroll.jsR

    ramswaroop/animatescroll.js

    0View on GitHub↗
    View on GitHub↗0
  • rstacruz/jquery.transitrstacruz avatar

    rstacruz/jquery.transit

    7,240View on GitHub↗

    This project is a jQuery plugin and animation extension that enables hardware-accelerated CSS3 transitions and transformations. It serves as a wrapper that shifts animation logic from script-based updates to native browser style transitions. The library provides tools for managing the scale, rotation, and orientation of page elements. It uses relative-value coordinate calculations to handle element movement and maps generic transformation properties to browser-specific vendor prefixes. The capability surface covers high-performance visual effects, including the management of timing and easin

    JavaScript
    View on GitHub↗7,240
  • rubaxa/sortableRubaXa avatar

    RubaXa/Sortable

    31,135View on GitHub↗

    Sortable is a JavaScript drag and drop library used to create reorderable lists of HTML elements. It is a framework-agnostic tool and a touch-enabled interaction library that functions across modern browsers and touch devices without dependencies on specific web frameworks. The library enables the movement and cloning of elements between different containers using shared group configurations. It supports the repositioning of multiple items simultaneously and the use of specific drag handles to restrict which areas of an element trigger a move. Additional capabilities include programmatic sor

    JavaScript
    View on GitHub↗31,135
  • thomasxiii/lenticular.jsT

    thomasxiii/lenticular.js

    0View on GitHub↗
    View on GitHub↗0