awesome-repositories.com
Blog
MCP
awesome-repositories.com

Discover the best open-source repositories with AI-powered search.

ExploreCurated searchesOpen-source alternativesSelf-hosted softwareBlogSitemap
ProjectMCP serverAboutHow we rankPress
LegalPrivacyTerms
© 2026 Bringes Technology SRL·VAT RO45896025·hello@awesome-repositories.com
Back to nhaarman/listviewanimations

Projects sharing features with ListViewAnimations

30 open-source projects similar to nhaarman/listviewanimations, ranked by shared indexed features. Tags may describe platforms or build tools rather than the same primary purpose. Check each project’s use case, license, and deployment requirements before treating it as a replacement.

  • cymcsg/ultimaterecyclerviewcymcsg avatar

    cymcsg/UltimateRecyclerView

    7,173View on GitHub↗

    UltimateRecyclerView is an advanced list component for Android that provides built-in support for animations, sticky headers, and pull-to-refresh. It functions as a specialized set of UI elements designed to handle draggable, expandable, infinite-scrolling, and swipeable list interfaces. The project includes a draggable list manager for reordering items through drag-and-drop interactions and an expandable list component for toggling additional item details. It implements a swipe-to-dismiss interface for item removal and a list controller that enables infinite scroll pagination by triggering d

    Javaandroidjavarecyclerview
    View on GitHub↗7,173
  • wasabeef/recyclerview-animatorswasabeef avatar

    wasabeef/recyclerview-animators

    11,543View on GitHub↗

    This library is an Android animation framework designed to manage the visual transitions and entrance effects of dynamic list components. It provides a collection of pre-built animation primitives that trigger automatically when items are added, removed, or moved within a list, allowing developers to apply polished motion effects to interface elements. The project distinguishes itself by offering granular control over the timing, interpolation, and sequencing of these transitions. It supports the composition of multiple animation layers and the implementation of staggered motion effects, whic

    Kotlinandroidandroid-libraryanimation
    View on GitHub↗11,543
  • traex/rippleeffecttraex avatar

    traex/RippleEffect

    4,895View on GitHub↗

    RippleEffect is a library and interaction framework for implementing Material Design ripple animations within Android applications. It provides tools to add animated visual feedback to interface elements to signal successful user interactions. The library allows for the customization of ripple effects, including adjustments to color, duration, and scale. It supports both configuration via attributes and dynamic adjustments through setter methods, and includes a listener interface to detect when a ripple animation has finished its execution.

    Java
    View on GitHub↗4,895

AI search

Explore more awesome repositories

Describe what you need in plain English — the AI ranks thousands of curated open-source projects by relevance.

Find more with AI search
  • ybq/android-spinkitybq avatar

    ybq/Android-SpinKit

    8,646View on GitHub↗

    Android-SpinKit is an Android animation library that provides a collection of animated loading spinner views for use as progress indicators during asynchronous operations. The library offers multiple predefined animation styles, including Circle, Wave, and DoubleBounce, which can be selected and displayed as standard Android View elements within an application's layout. The library distinguishes itself by being built entirely on the Android SDK's drawing and animation APIs, with no external dependencies required. Each spinner type implements a distinct animation state machine using Android's

    Javaandroid-loadinganimationloading
    View on GitHub↗8,646
  • daimajia/androidviewanimationsdaimajia avatar

    daimajia/AndroidViewAnimations

    12,446View on GitHub↗

    AndroidViewAnimations is an animation library and visual effects toolkit for Android applications. It provides a framework for implementing motion effects, such as bouncing, sliding, and rotating transitions, for views within Android layouts. The library features a collection of predefined motion presets and stylized transition effects. These include curated sequences for shaking and pulsing to guide user attention, as well as complex movements like hinging or rolling for interface entry and exit. The toolkit covers a wide range of visual effects, including linear slides, elastic bounces, tr

    Javaandroidanimationeasing-functions
    View on GitHub↗12,446
  • andkulikov/transitions-everywhereandkulikov avatar

    andkulikov/transitions-everywhere

    4,785View on GitHub↗

    Transitions Everywhere is an Android view animation library and UI transition framework. It serves as an extension to the Jetpack Transitions library, providing a toolkit for implementing motion and recoloring animations during element transitions. The library enables the creation of custom scale, translation, and rotation effects to manage visual state changes in mobile interfaces. It provides a set of additional animation effects built on top of the Android Jetpack framework to achieve a dynamic visual experience. The framework covers view transition customization and UI motion design, uti

    Java
    View on GitHub↗4,785
  • rubaxa/sortableRubaXa avatar

    RubaXa/Sortable

    31,135View on GitHub↗

    Sortable is a JavaScript drag and drop library used to create reorderable lists of HTML elements. It is a framework-agnostic tool and a touch-enabled interaction library that functions across modern browsers and touch devices without dependencies on specific web frameworks. The library enables the movement and cloning of elements between different containers using shared group configurations. It supports the repositioning of multiple items simultaneously and the use of specific drag handles to restrict which areas of an element trigger a move. Additional capabilities include programmatic sor

    JavaScript
    View on GitHub↗31,135
  • airbnb/epoxyairbnb avatar

    airbnb/epoxy

    8,556View on GitHub↗

    Epoxy is an Android library for building complex RecyclerView screens using a model-driven approach. It generates RecyclerView adapter models at compile time from annotated custom views, data binding layouts, or view holders, eliminating the manual boilerplate typically associated with view holders and adapters. The library provides a diffing engine that automatically compares model lists and applies minimal updates with animations for insertions, removals, and moves. The library distinguishes itself through its controller-based model building, where a controller class with a buildModels meth

    Java
    View on GitHub↗8,556
  • formkit/auto-animateformkit avatar

    formkit/auto-animate

    13,847View on GitHub↗

    Auto-animate is a framework-agnostic JavaScript animation library used to automatically animate the entry, exit, and movement of elements within a document. It functions as a transition tool that adds smooth motion to web application elements to prevent abrupt layout jumps during content changes. The utility is designed to be reduced motion compliant, automatically detecting and respecting system-level accessibility settings to disable animations for users with motion sensitivities. It also features a plugin system that allows the replacement of default fade and scale transitions with custom

    TypeScriptanimationjavascriptreact
    View on GitHub↗13,847
  • joshwcomeau/react-flip-movejoshwcomeau avatar

    joshwcomeau/react-flip-move

    4,139View on GitHub↗

    react-flip-move is a React animation library designed for animating DOM element transitions and list reordering using the FLIP technique. It functions as a layout transition component and a DOM transition utility to create smooth movement during state changes. The library specializes in hardware-accelerated transitions for elements as they are added, removed, or reordered within a list. It employs bounding-box position tracking to calculate layout shifts and supports staggered animation timing to create sequenced visual flows. Its capability surface covers layout transition orchestration, in

    JavaScript
    View on GitHub↗4,139
  • sghall/react-movesghall avatar

    sghall/react-move

    6,564View on GitHub↗

    React Move is a declarative animation library for React that animates components by interpolating between start and end states with configurable timing and easing. It provides data-driven transitions for single elements, groups, lists, and SVG elements, supporting staggered timing, custom interpolation for non-numeric values like colors and paths, and drag-and-drop reordering of list items. The library distinguishes itself through its support for custom interpolation functions that replace default numeric interpolation, keyed array reconciliation for tracking items as they enter, update, or l

    JavaScriptanimateanimationeasing
    View on GitHub↗6,564
  • jakewharton/nineoldandroidsJakeWharton avatar

    JakeWharton/NineOldAndroids

    4,463View on GitHub↗

    NineOldAndroids is an Android animation backport library and UI compatibility layer. It brings the Honeycomb animation API to all Android platform versions, extending support back to version 1.0. The library serves as a platform backport that enables the execution of modern system APIs on older versions of the Android operating system. This ensures consistent visual transitions and animation sequences across legacy and modern device versions. It provides capabilities for Android API backporting and legacy animation support to maintain cross-version UI consistency across supported hardware.

    Java
    View on GitHub↗4,463
  • mcxtzhang/swipedelmenulayoutmcxtzhang avatar

    mcxtzhang/SwipeDelMenuLayout

    3,791View on GitHub↗

    SwipeDelMenuLayout is an Android gesture interaction library that provides a swipe-to-reveal layout container. It allows developers to add slide-out action menus to list items by wrapping existing layouts in a specialized container without modifying the underlying view structure. The library includes a diagnostic performance monitor that hooks into the system display pipeline to detect frame drops and identify janky animations. It manages interaction coordination through velocity tracking and touch event interception to prevent conflicts between child menus and parent scrolling views. The co

    Javalistviewrecyclerviewsideslip-menu
    View on GitHub↗3,791
  • ikew0ng/swipebacklayoutikew0ng avatar

    ikew0ng/SwipeBackLayout

    6,089View on GitHub↗

    SwipeBackLayout is an Android gesture navigation library that provides the mechanisms for implementing native-style edge-swipe interactions and view transitions. It functions as a swipe-to-dismiss layout manager and touch event interceptor, allowing users to return to previous screens through physical touch gestures. The library manages the visual transition between screens using a coordinate-based translation system. This includes the use of alpha scaling, view-hierarchy layering, and horizontal translation to maintain visual continuity during navigation. The system includes tools for defin

    Java
    View on GitHub↗6,089
  • h6ah4i/android-advancedrecyclerviewh6ah4i avatar

    h6ah4i/android-advancedrecyclerview

    5,322View on GitHub↗

    This project is an extension library for Android RecyclerView, providing a toolkit for implementing advanced list interactions. It functions as a framework for adding drag-and-drop sorting, swipe actions, and custom row behaviors to list and grid displays. The library includes a dedicated manager for reordering elements via drag-and-drop and a swipe action framework that reveals hidden buttons through horizontal gestures. It also provides utilities for creating expandable rows and filtered views. Additional capabilities cover list section composition for headers and footers, data filtering t

    Javaandroiddrag-and-dropexpandable
    View on GitHub↗5,322
  • pkluz/pkrevealcontrollerpkluz avatar

    pkluz/PKRevealController

    3,830View on GitHub↗

    PKRevealController is an iOS navigation framework and slide-over UI controller. It functions as a gesture-based interface library and hierarchical view controller manager that allows secondary screens to slide over a primary content area through touch interactions. The system organizes parent and child controllers into a layered navigation structure, translating touch input into coordinate offsets to animate transitions. It manages the width and positioning of side panels to control the available screen real estate. The framework provides capabilities for side panel layout management and vie

    Objective-C
    View on GitHub↗3,830
  • viewdeck/viewdeckV

    ViewDeck/ViewDeck

    5,268View on GitHub↗

    ViewDeck is a side menu management framework and gesture-based navigation library for iOS. It provides a system for coordinating the presentation, animation, and interaction logic of left and right side menus within a container view controller. The framework features a dynamic menu controller that allows for updating or removing active menu controllers at runtime to modify available navigation options. It includes a transition coordinator to manage custom motion and visual properties for sliding navigation panels. The library supports both programmatic menu control and gesture-based activati

    Objective-C
    View on GitHub↗5,268
  • yalantis/kolodaYalantis avatar

    Yalantis/Koloda

    5,400View on GitHub↗

    Koloda is an iOS gesture interaction library and SwiftUI view component used to create swipeable card interfaces. It provides a stack-based view component that manages overlapping views, ensuring only the top-most element remains actively interactive. The library allows for the customization of card appearance, including the configuration of overlays and animations that dictate how background cards move during a swipe. It manages drag behavior and swipe directions, triggering specific logic when cards are swiped, tapped, or fully exhausted. The component covers the implementation of gesture-

    Swift
    View on GitHub↗5,400
  • reactjs/react-transition-groupreactjs avatar

    reactjs/react-transition-group

    10,258View on GitHub↗

    This project is a transition component library for React that manages CSS animations during the mounting and unmounting of components. It functions as a CSS class state manager and animation orchestrator, applying specific class sequences to track the entry and exit states of elements. The library coordinates the timing and sequence of multiple elements entering or leaving the screen. This includes managing synchronized group transitions for lists and triggering visual animations when switching between different URL routes. The system covers a range of transition capabilities, including stat

    JavaScript
    View on GitHub↗10,258
  • sortablejs/sortableSortableJS avatar

    SortableJS/Sortable

    31,135View on GitHub↗

    Sortable is a framework-agnostic JavaScript library for creating reorderable lists through drag and drop interactions. It functions as a reorderable list manager that allows users to rearrange DOM elements using pointer interactions on modern browsers and touch devices. The library enables the transfer or cloning of items between different lists using shared group identifiers. It supports complex organizational structures, including nested reorderable lists for managing hierarchical data across different levels. Its capabilities cover the animation of element movements and the configuration

    JavaScriptdragdrag-and-dropdrag-drop
    View on GitHub↗31,135
  • chenglou/react-motionchenglou avatar

    chenglou/react-motion

    21,921View on GitHub↗

    react-motion is a physics-driven animation toolkit and library for React applications. It provides a system for creating fluid user interface transitions by simulating natural spring movement to move elements toward destination values using stiffness and damping parameters. The framework manages the visual entry and exit of components as they mount and unmount within the document structure. It coordinates complex motion patterns, including staggered animations and fluid transitions for items being added, removed, or reordered within dynamic lists. The library covers a broad range of animatio

    JavaScript
    View on GitHub↗21,921
  • ygs-code/vueygs-code avatar

    ygs-code/vue

    7,321View on GitHub↗

    This project is a technical study guide and architectural analysis of the Vue.js framework. It serves as an educational resource for understanding the implementation of a reactive framework, providing source code analysis and architectural visualizations to explain the internal workings of the Model-View-ViewModel pattern. The project focuses on the mechanics of reactive framework implementation, specifically how dependency tracking, getters, and setters are used to synchronize state with a user interface. It includes detailed examinations of the virtual DOM and the process of reconciling ele

    JavaScript
    View on GitHub↗7,321
  • vuejs/v2.vuejs.orgvuejs avatar

    vuejs/v2.vuejs.org

    4,981View on GitHub↗

    This is the comprehensive documentation website for the Vue 2 progressive JavaScript framework. It serves as a technical reference and development guide for building reactive user interfaces and single-page applications. The site provides a detailed JavaScript API reference and a web component directory. It covers the implementation of component-based architectures, reactive state management, and the use of a virtual DOM to synchronize application state with the browser. The documentation details capabilities including client-side routing, declarative DOM manipulation, and frontend build opt

    JavaScript
    View on GitHub↗4,981
  • flutter/samplesflutter avatar

    flutter/samples

    19,172View on GitHub↗

    This is a comprehensive library of code examples and reference implementations for building cross-platform user interfaces with Flutter. The project provides a collection of demo applications and guides designed to illustrate the implementation of design patterns, animation techniques, and testing workflows. The repository features specific demonstrations for native integration, including examples of embedding modules into existing native applications, using platform channels, and bridging native code with the framework. It also serves as an animation reference, providing implementations for

    Dart
    View on GitHub↗19,172
  • dmytrodanylyk/circular-progress-buttondmytrodanylyk avatar

    dmytrodanylyk/circular-progress-button

    5,749View on GitHub↗

    This is an Android button widget that morphs into a circular progress indicator during asynchronous operations. The core identity of the project is a custom UI component that transforms a standard button into a loading spinner, then reverts it upon task completion. The implementation uses canvas-based morphing animation to transition between button and circular progress shapes, with property animation interpolation controlling the transformation over time. A state-driven view hierarchy switches between button and progress indicator layouts based on a finite state machine, while layer-based co

    Java
    View on GitHub↗5,749
  • desandro/masonrydesandro avatar

    desandro/masonry

    16,709View on GitHub↗

    Masonry is a JavaScript library for arranging elements of varying heights into a grid without vertical gaps. It serves as a DOM element positioner and dynamic layout manager that calculates and applies absolute coordinates to HTML elements based on available vertical space. The system functions as a responsive grid engine using percentage-based widths to maintain consistent structures across different screen sizes. It includes capabilities to recalculate grid positions after images load or browser windows resize to prevent element overlap. The library covers grid management and positioning,

    HTML
    View on GitHub↗16,709
  • tahash/swapyTahaSh avatar

    TahaSh/swapy

    8,452View on GitHub↗

    Swapy is a drag and drop layout library designed to manage the spatial arrangement of UI components. It functions as an element reordering tracker and visual position manager that exports updated layout sequences as data objects after user interactions. The system monitors changes to the visual order of elements to provide updated layout mappings. It enables the rearrangement of on-screen elements through drag and drop interactions to update visual layout mappings. The library covers dynamic layout management and visual element sorting by converting the visual positions of screen elements in

    TypeScript
    View on GitHub↗8,452
  • gizak/termuigizak avatar

    gizak/termui

    13,574View on GitHub↗

    Termui is a Go terminal user interface library used for building interactive dashboards and visual layouts within a command-line environment. It functions as a TUI layout engine, an interactive CLI framework, and a terminal data visualization toolkit. The library provides a set of specialized widgets for rendering charts, plots, gauges, and tables using character-based graphics. It includes a grid-based system for arranging interface elements using relative coordinates and proportional sizing to create structured displays. The toolkit covers a broad range of capabilities including data visua

    Go
    View on GitHub↗13,574
  • alibaba/ultraviewpageralibaba avatar

    alibaba/UltraViewPager

    4,954View on GitHub↗

    UltraViewPager is an Android UI component and ViewPager extension that provides a library of page transition animations and an infinite paging controller for mobile screens. It functions as a reusable interface element for rendering paging containers with custom dimensions and aspect ratios. The project implements circular paging navigation that cycles back to the first page after the final screen is reached, creating a continuous loop. It also includes a timer-driven mechanism for automated content rotation and a coordinate-based engine to interpolate view positions and alpha values during p

    Javaandroidmulti-page-switchingtangram
    View on GitHub↗4,954
  • keepsafe/taptargetviewKeepSafe avatar

    KeepSafe/TapTargetView

    5,461View on GitHub↗

    TapTargetView is a set of UI components designed for user onboarding and feature discovery. It provides visual callouts, focus indicators, and markers that direct user attention toward specific screen elements to introduce new or hidden functionality. The system implements Material Design guidelines for its feature discovery UI, ensuring that visual highlights and interactive callouts remain consistent with standardized design specifications. It supports the creation of interactive product tours by chaining multiple interaction points into a sequential path. This is achieved through coordina

    Java
    View on GitHub↗5,461