awesome-repositories.com
Blog
MCP
awesome-repositories.com

Discover the best open-source repositories with AI-powered search.

ExploreCurated searchesOpen-source alternativesSelf-hosted softwareBlogSitemap
ProjectMCP serverAboutHow we rankPress
LegalPrivacyTerms
© 2026 Bringes Technology SRL·VAT RO45896025·hello@awesome-repositories.com
Back to issacw0ng/swipebacklayout

Projects sharing features with SwipeBackLayout

30 open-source projects similar to issacw0ng/swipebacklayout, ranked by shared indexed features. Tags may describe platforms or build tools rather than the same primary purpose. Check each project’s use case, license, and deployment requirements before treating it as a replacement.

  • mutualmobile/mmdrawercontrollermutualmobile avatar

    mutualmobile/MMDrawerController

    6,714View on GitHub↗

    MMDrawerController is a side drawer navigation controller for mobile applications. It serves as a mobile UI navigation container that organizes a primary center content area and a hidden slide-out side menu. The project provides a transition animation framework to define custom visual effects when presenting or dismissing the side menu. It also includes a system for customizable gesture navigation, allowing the definition of touch gestures and pan events to trigger menu transitions. The controller covers app layout management via a container view and integrates iOS gesture recognition. It in

    Objective-C
    View on GitHub↗6,714
  • ealeksandrov/eaintroviewealeksandrov avatar

    ealeksandrov/EAIntroView

    3,736View on GitHub↗

    EAIntroView is an onboarding UI library used to build sequential introduction and welcome screens. It functions as a customizable walkthrough and interactive tutorial framework for creating guided tours and step-by-step instructional guides. The library features a coordinate-based layout engine that defines UI element placement using coordinates and offsets mapped to individual pages. It includes an event-driven UI component that triggers specific logic and animations based on page transition and visibility events. The framework manages view navigation through a navigation-controlled introdu

    Objective-Cdemointroios
    View on GitHub↗3,736
  • ikew0ng/swipebacklayoutikew0ng avatar

    ikew0ng/SwipeBackLayout

    6,089View on GitHub↗

    SwipeBackLayout is an Android gesture navigation library that provides the mechanisms for implementing native-style edge-swipe interactions and view transitions. It functions as a swipe-to-dismiss layout manager and touch event interceptor, allowing users to return to previous screens through physical touch gestures. The library manages the visual transition between screens using a coordinate-based translation system. This includes the use of alpha scaling, view-hierarchy layering, and horizontal translation to maintain visual continuity during navigation. The system includes tools for defin

    Java
    View on GitHub↗6,089

AI search

Explore more awesome repositories

Describe what you need in plain English — the AI ranks thousands of curated open-source projects by relevance.

Find more with AI search
  • mcxtzhang/swipedelmenulayoutmcxtzhang avatar

    mcxtzhang/SwipeDelMenuLayout

    3,791View on GitHub↗

    SwipeDelMenuLayout is an Android gesture interaction library that provides a swipe-to-reveal layout container. It allows developers to add slide-out action menus to list items by wrapping existing layouts in a specialized container without modifying the underlying view structure. The library includes a diagnostic performance monitor that hooks into the system display pipeline to detect frame drops and identify janky animations. It manages interaction coordination through velocity tracking and touch event interception to prevent conflicts between child menus and parent scrolling views. The co

    Javalistviewrecyclerviewsideslip-menu
    View on GitHub↗3,791
  • software-mansion/react-native-gesture-handlersoftware-mansion avatar

    software-mansion/react-native-gesture-handler

    6,755View on GitHub↗

    React Native Gesture Handler is a declarative library that exposes the platform's native touch and gesture system to React Native, enabling smooth, deterministic gesture handling on the UI thread. It manages gesture recognition through a native state machine with defined transitions between states like BEGAN, ACTIVE, END, and CANCELLED, routing touch events through platform-native gesture recognizers on both iOS and Android. The library provides a comprehensive gesture composition framework that allows developers to combine multiple gestures into race, simultaneous, or exclusive sequences, co

    TypeScriptgesturejavascriptreact-native
    View on GitHub↗6,755
  • flutterchina/flukitflutterchina avatar

    flutterchina/flukit

    5,940View on GitHub↗

    Flukit is a suite of functional toolkits for Flutter, providing animation wrappers, layout debugging tools, scroll interaction kits, and a library of reusable UI components and visual utilities. The project distinguishes itself through a dedicated layout debugging tool for inspecting parent constraints and capturing system logs directly within the interface. It also provides specialized animation wrappers for rotating, scaling, and sliding child components and a scroll interaction kit that includes pull-to-refresh mechanisms, carousel swipers, and flexible sliver headers. The library covers

    Dartflutter
    View on GitHub↗5,940
  • gcssloop/androidnoteGcsSloop avatar

    GcsSloop/AndroidNote

    9,332View on GitHub↗

    AndroidNote is a technical knowledge base and reference resource for Android development. It provides comprehensive guidance on application architecture, custom view development, and advanced graphics programming. The project is distinguished by its depth in visual implementation, covering pseudo-3D perspective projections via virtual cameras and complex 2D rendering using Bézier curves and PorterDuff color blending. It also provides detailed methodologies for app modularization and the management of internal libraries through private Maven repositories and JitPack. The reference surface ext

    Javaandroidandroid-studiocustom-view
    View on GitHub↗9,332
  • yokeyword/fragmentationYoKeyword avatar

    YoKeyword/Fragmentation

    9,688View on GitHub↗

    Fragmentation is an Android fragment management library and navigation framework. It coordinates the lifecycle, transactions, and navigation of fragments to reduce boilerplate code. The framework provides a system for handling back-stack operations, transition animations, and activity-like launch modes between fragments. It includes a navigation debugger with visual tools for inspecting the fragment hierarchy and monitoring the navigation stack in real time. The library covers fragment communication through activity-scoped event buses, lifecycle coordination with lazy view initialization, an

    Javaactivity-fragmentfragmentswipeback
    View on GitHub↗9,688
  • romaonthego/residemenuromaonthego avatar

    romaonthego/RESideMenu

    7,048View on GitHub↗

    RESideMenu is an iOS side menu component and user interface framework element used to implement the side-drawer navigation pattern on Apple mobile devices. It provides a sliding side panel that organizes top-level application sections and navigation links. The component specifically implements a parallax navigation menu, which shifts content layers at different speeds to create a sense of depth during transitions. This allows for the creation of a sliding menu that moves content visually when controllers are opened from either side of the screen. The system manages the interface through gest

    Objective-C
    View on GitHub↗7,048
  • gontovnik/dgelasticpulltorefreshgontovnik avatar

    gontovnik/DGElasticPullToRefresh

    3,745View on GitHub↗

    DGElasticPullToRefresh is a Swift pull-to-refresh component for iOS that provides a bouncy, elastic animation effect for scrolling lists. It serves as a specialized table view extension that triggers content updates via a downward swipe gesture. The component uses bezier paths and spring physics to render curved visual elements, simulating a flexible stretching effect during user interaction. This physics-based approach governs the movement and bounce of the interface to create a fluid feel. The system manages gesture-driven states and coordinate transformations to shift the view hierarchy.

    Swift
    View on GitHub↗3,745
  • forkingdog/fdfullscreenpopgestureforkingdog avatar

    forkingdog/FDFullscreenPopGesture

    5,888View on GitHub↗

    FDFullscreenPopGesture is an iOS navigation gesture library and UIKit enhancement designed to implement edge-swipe back navigation and automatic navigation bar transitions in iOS applications. It provides a category for navigation controllers that adds a fullscreen swipe-to-pop gesture matching the system interaction style. The library manages the synchronization of navigation bar visibility animations during fullscreen transitions. This ensures that view controllers which do not natively support edge-swipe navigation can utilize system-standard back gestures. The project covers user interfa

    Objective-C
    View on GitHub↗5,888
  • alibaba/vlayoutalibaba avatar

    alibaba/vlayout

    10,740View on GitHub↗

    vlayout is an Android RecyclerView extension framework that uses pluggable layout helpers to mix grid, list, sticky, staggered, and fixed layouts within a single scrollable view. It provides a modular layout delegation system where each section of the RecyclerView is assigned a dedicated layout helper that manages its own measurement, placement, and decoration, enabling complex heterogeneous content displays. The framework extends RecyclerView's LayoutManager to delegate layout logic to these modular helper components, supporting features like sticky headers that remain visible at the top dur

    Javaandroidlayoutlayout-manager
    View on GitHub↗10,740
  • hackiftekhar/iqkeyboardmanagerhackiftekhar avatar

    hackiftekhar/IQKeyboardManager

    16,623View on GitHub↗

    IQKeyboardManager is an iOS keyboard management library and UI layout utility. It automatically adjusts screen layouts to prevent the software keyboard from covering text input fields. The project provides a customizable keyboard toolbar component with navigation buttons and action triggers. It enables focus management, allowing users to move between text fields via the return key or toolbar controls. The library covers keyboard layout coordination, including touch-based dismissal and offset configuration. It also includes a system for managing keyboard behaviors and appearance on a per-clas

    Swift
    View on GitHub↗16,623
  • roughike/bottombarroughike avatar

    roughike/BottomBar

    8,358View on GitHub↗

    BottomBar is an Android UI component that implements a Material Design bottom navigation bar. It serves as a reusable layout element for organizing top-level application destinations through a system of selectable tabs. The component features an adaptive layout system that optimizes horizontal space for tablet displays and uses density-aware adjustments for different screen dimensions. It includes a notification badge system to alert users of updates and supports conditional selection interception to prevent navigation based on application state or permissions. The library covers a broad ran

    Javaandroidbottom-navigationjava
    View on GitHub↗8,358
  • umano/androidslidinguppanelumano avatar

    umano/AndroidSlidingUpPanel

    9,456View on GitHub↗

    AndroidSlidingUpPanel is an Android custom view component and sliding panel library used to create draggable overlays that slide up from the bottom of an application screen. It functions as a nested scrolling UI framework that coordinates touch events between a draggable panel and its internal scrollable content. The library distinguishes itself through a parallax effect implementation that shifts background content at different speeds than the foreground panel. It supports the definition of intermediate anchor points to create partial-view states and allows for transition physics customizati

    Java
    View on GitHub↗9,456
  • gabrielemariotti/cardslibgabrielemariotti avatar

    gabrielemariotti/cardslib

    4,618View on GitHub↗

    cardslib is an Android UI component library and card layout framework. It provides a set of specialized adapters and views designed as an extension for high-performance card rendering within recycling lists. The library distinguishes itself through a reorderable list implementation that supports drag-and-drop item rearrangement and nested content hierarchies. It also includes an interaction system for managing directional swipe constraints and a customizable undo action notification bar. The framework covers a broad range of card-based interface capabilities, including the composition of vis

    Java
    View on GitHub↗4,618
  • chrisbanes/photoviewchrisbanes avatar

    chrisbanes/PhotoView

    18,824View on GitHub↗

    PhotoView is a custom Android view implementation designed to display high-resolution images with native support for zoom and pan gestures. It provides a zoomable image view and a matrix controller to manage how images are scaled and translated within a mobile user interface. The library handles the detection of pinch-to-zoom and tap gestures to enable interactive image navigation. It manages the transformation matrix of the image to ensure smooth magnification and provides viewport constraints to align photo edges with screen boundaries. The project covers the broader requirements of mobile

    Java
    View on GitHub↗18,824
  • amlcurran/showcaseviewamlcurran avatar

    amlcurran/ShowcaseView

    5,551View on GitHub↗

    ShowcaseView is an iOS UI overlay library and user onboarding framework. It provides a customizable feature highlight component designed to visually isolate and emphasize specific buttons or sections of a mobile user interface. The library enables the creation of interactive product tours and in-app feature discovery by drawing attention to specific interface elements. It allows for the customization of highlight appearances, including colors and shapes, to match the visual theme of the application. The framework manages the user onboarding experience by highlighting UI elements and guiding

    Java
    View on GitHub↗5,551
  • herotransitions/heroHeroTransitions avatar

    HeroTransitions/Hero

    22,462View on GitHub↗

    Hero is a transition framework and animation toolkit for iOS and tvOS designed to create fluid visual continuity between screens. It provides a shared element animation library that interpolates the position and size of views across different screens using unique identifiers. The framework includes an interactive transition controller that binds navigation progress to manual gestures and user input events in real time. It utilizes a system for calculating animation durations based on element distance and size to maintain a consistent sense of motion speed. The toolkit covers global coordinat

    Swift
    View on GitHub↗22,462
  • ganlanyuan/tiny-sliderganlanyuan avatar

    ganlanyuan/tiny-slider

    5,333View on GitHub↗

    Tiny-slider is a vanilla JavaScript carousel library used to create touch-enabled content sliders and accessible UI components without external dependencies. It functions as a responsive layout engine that adjusts slide visibility and dimensions based on viewport breakpoints. The library distinguishes itself through built-in lazy loading for images and media to improve page performance and a responsive system that automatically scales item counts and spacing according to the device screen size. It also supports nested slider instances, allowing for the creation of multi-directional scrolling

    HTMLcarouselslider
    View on GitHub↗5,333
  • mango/slideoutmango avatar

    mango/slideout

    7,881View on GitHub↗

    Slideout is a touch-gesture UI component and navigation menu designed for mobile web applications. It provides a side panel that slides across the screen to reveal navigation options, utilizing CSS transitions to animate the movement of the viewport. The component manages the expanded or collapsed state of the navigation menu and includes logic to restrict gestures for specific interface elements to prevent interaction conflicts. It employs a system for executing custom logic triggered by menu state transitions and user drag gestures.

    JavaScript
    View on GitHub↗7,881
  • dcloudio/muidcloudio avatar

    dcloudio/mui

    13,474View on GitHub↗

    mui is a mobile UI component framework and native-like web UI kit designed for building high-performance mobile web interfaces. It functions as a mobile web performance framework and gesture-based interface library to eliminate browser lag and mimic the behaviors and animations of native mobile applications. The framework focuses on implementing common mobile UX patterns, including pull-to-refresh functionality, swipe-to-action menus, and sliding side navigation. It provides specialized tools for gesture-driven interface development to ensure an immediate visual response to touch interactions

    JavaScriptandroidcssdcloud
    View on GitHub↗13,474
  • android/views-widgets-samplesandroid avatar

    android/views-widgets-samples

    5,165View on GitHub↗

    This repository is a collection of reference implementations and galleries demonstrating best practices for the Android View system. It provides a set of practical examples for building user interfaces, including a component gallery and implementation guides for layouts, list performance, and motion design. The project distinguishes itself through detailed samples for coordinating layout animations and transition effects. It includes specialized demonstrations for complex motion animations using keyframes and interpolation, as well as a visualization tool for animation interpolation curves to

    Java
    View on GitHub↗5,165
  • jonkykong/sidemenujonkykong avatar

    jonkykong/SideMenu

    5,819View on GitHub↗

    SideMenu is an iOS navigation menu library and mobile app navigation framework written in Swift. It provides reusable components for implementing animated slide-out side menus and navigation drawers within iOS applications. The framework supports continuous swiping navigation, allowing users to transition between menus on opposite sides of the screen in a single motion. It includes a coordination system to manage multiple menu instances across different navigation levels and a global configuration mechanism to ensure consistent behavior and appearance across all application screens. The libr

    Swift
    View on GitHub↗5,819
  • hongyangandroid/flowlayouthongyangAndroid avatar

    hongyangAndroid/FlowLayout

    5,579View on GitHub↗

    FlowLayout is a custom Android view widget designed to wrap child elements across multiple lines. It functions as an adapter-based layout that populates and updates flowing content from a data source, specifically for displaying collections of tags or chips. The component includes a tag selection system that supports single or multiple selection modes with configurable limits. It manages user interactions through tag click handling and includes a state manager to persist selection indices across activity reconstruction and screen rotations. The library provides capabilities for dynamic data

    Java
    View on GitHub↗5,579
  • ramonszo/zuck.jsramonszo avatar

    ramonszo/zuck.js

    3,728View on GitHub↗

    zuck.js is a JavaScript UI library used to build JSON-driven story viewers and timelines. It provides a touch-based interface for rendering sequences of full-screen content, enabling the integration of social media style story layouts into web applications. The library features a customizable theme engine that allows for different visual styles and hardware-accelerated 3D transition effects, such as cube transitions, when switching between story sets. It employs mobile UI emulation to replicate native application experiences through fullscreen layouts and gesture-based navigation. The toolki

    TypeScriptfacebookinstagrammedia
    View on GitHub↗3,728
  • h5bp/effeckt.cssh5bp avatar

    h5bp/Effeckt.css

    10,817View on GitHub↗

    Effeckt.css is a hardware-accelerated CSS animation library and UI transition framework. It provides a collection of styles designed to create smooth element entrances, exits, and attention-grabbing visual effects while preventing visual stuttering during interface transitions. The library focuses on high-performance animations using GPU-accelerated properties to ensure fluid movement. It enables the simulation of application navigation by sliding page views in and out of the viewport from specified directions. The framework covers a suite of visual capabilities, including directional entran

    CSS
    View on GitHub↗10,817
  • lucasr/twoway-viewlucasr avatar

    lucasr/twoway-view

    5,204View on GitHub↗

    Twoway-view is a Java library for Android list UI development designed to simplify the creation of custom list and grid interfaces. It focuses on reducing repetitive boilerplate code when building complex item arrangements and custom layouts. The project provides tools for custom layout manager design and sequence layout management, allowing for precise structural positioning of items. It includes mechanisms for list layout simplification and the rendering of custom user interface layouts. The library covers a broad range of list capabilities, including item decoration management for visual

    Java
    View on GitHub↗5,204
  • ftlabs/fastclickftlabs avatar

    ftlabs/fastclick

    18,534View on GitHub↗

    Fastclick is a JavaScript library and touch event optimization tool designed to remove the 300ms delay between a physical tap and a click event on mobile browsers. It functions as a lightweight DOM event handler middleware that manages touch-to-click timing to reduce input lag and improve the responsiveness of mobile web interfaces. The library provides granular control over touch latency removal, including a mechanism to exclude specific elements from this optimization. This allows certain user interface components to maintain native browser touch behavior via CSS class identifiers. The pro

    HTML
    View on GitHub↗18,534
  • react-native-modal/react-native-modalreact-native-modal avatar

    react-native-modal/react-native-modal

    5,657View on GitHub↗

    This is a mobile UI overlay library for React Native that provides an animated modal component. It functions as a gesture-responsive interface element used to present supplementary content via overlay windows that support custom transitions and dynamic layout adjustments. The library features a dynamic layout observer that automatically resizes and repositions components during screen rotations or when the on-screen keyboard appears. It implements gesture-based navigation, allowing users to dismiss overlays through configured swipe gestures and backdrop interactions. The project covers anima

    TypeScriptandroidanimatedanimation
    View on GitHub↗5,657