awesome-repositories.com
Blog
MCP
awesome-repositories.com

Discover the best open-source repositories with AI-powered search.

ExploreCurated searchesOpen-source alternativesSelf-hosted softwareBlogSitemap
ProjectMCP serverAboutHow we rankPress
LegalPrivacyTerms
© 2026 Bringes Technology SRL·VAT RO45896025·hello@awesome-repositories.com
Back to alloyteam/alloylever

Projects sharing features with AlloyLever

30 open-source projects similar to alloyteam/alloylever, ranked by shared indexed features. Tags may describe platforms or build tools rather than the same primary purpose. Check each project’s use case, license, and deployment requirements before treating it as a replacement.

  • yalantis/phoenixYalantis avatar

    Yalantis/Phoenix

    3,975View on GitHub↗

    Phoenix is a JavaScript gesture library and mobile-first interaction toolset designed to manage touch events and scroll behaviors in web-based interfaces. Its primary purpose is to provide a pull-to-refresh UI component that triggers data updates when a user pulls down on a mobile or web view. The library focuses on mobile web interaction design, providing themed animations and visual indicators that mimic native mobile app gestures. It enables the implementation of dynamic data refresh workflows through a downward drag interaction. The project covers the interception of scroll events and th

    Javaandroidanimationjava
    View on GitHub↗3,975
  • mcxtzhang/swipedelmenulayoutmcxtzhang avatar

    mcxtzhang/SwipeDelMenuLayout

    3,791View on GitHub↗

    SwipeDelMenuLayout is an Android gesture interaction library that provides a swipe-to-reveal layout container. It allows developers to add slide-out action menus to list items by wrapping existing layouts in a specialized container without modifying the underlying view structure. The library includes a diagnostic performance monitor that hooks into the system display pipeline to detect frame drops and identify janky animations. It manages interaction coordination through velocity tracking and touch event interception to prevent conflicts between child menus and parent scrolling views. The co

    Javalistviewrecyclerviewsideslip-menu
    View on GitHub↗3,791
  • alibaba/butterflyalibaba avatar

    alibaba/butterfly

    4,649View on GitHub↗

    Butterfly is an interactive graph visualization library and SVG-based diagramming engine used to build node-based workflow designers and visual flow editors. It provides a framework for rendering interconnected nodes, edges, and groups to model technical architectures, business processes, and data-driven workflows. The project is distinguished by its ability to integrate custom UI components as graph nodes and its specialized support for data lineage visualization. It enables the mapping of relationships between data fields, tables, and business entities to track provenance and monitor workfl

    JavaScript
    View on GitHub↗4,649

AI search

Explore more awesome repositories

Describe what you need in plain English — the AI ranks thousands of curated open-source projects by relevance.

Find more with AI search
  • alloyteam/alloyfingerAlloyTeam avatar

    AlloyTeam/AlloyFinger

    3,441View on GitHub↗

    Super tiny size multi-touch gestures library for the web. You can touch this →

    JavaScript
    View on GitHub↗3,441
  • alloyteam/alloytouchAlloyTeam avatar

    AlloyTeam/AlloyTouch

    2,964View on GitHub↗

    Smooth scrolling, rotation, pull to refresh, page transition and any motion for the web - 丝般顺滑的触摸运动方案

    JavaScript
    View on GitHub↗2,964
  • angular/angularangular avatar

    angular/angular

    100,360View on GitHub↗

    Angular is a platform for building web applications using a component-based architecture. It provides a comprehensive suite of tools for managing encapsulated UI units, including hierarchical dependency injection, a declarative template system, and fine-grained reactivity through signals. The framework supports complex application requirements such as client-side routing, form management, and internationalization. The project includes a command-line interface for scaffolding and build automation, alongside a testing ecosystem for unit and integration verification. It offers multiple rendering

    TypeScriptangularjavascriptpwa
    View on GitHub↗100,360
  • ant-design/ant-design-mobileant-design avatar

    ant-design/ant-design-mobile

    12,006View on GitHub↗

    Ant Design Mobile is a mobile UI component library and design system built for React. It provides a collection of pre-styled interface elements and standardized UI blocks used to create consistent, responsive user interfaces for mobile web applications. The framework focuses on mobile web design and frontend interface engineering, providing tools to implement interaction patterns tailored for touch-based browsing. It ensures a uniform look and feel across different mobile browsers and handheld device screens. The library incorporates responsive layout systems and CSS-variable-based theming.

    TypeScriptant-designantdantd-mobile
    View on GitHub↗12,006
  • biaogebusy/xinshi-uiB

    biaogebusy/xinshi-ui

    0View on GitHub↗
    View on GitHub↗0
  • ant-design/ant-design-proant-design avatar

    ant-design/ant-design-pro

    38,401View on GitHub↗

    Ant Design Pro is a comprehensive starter kit and administrative framework for building enterprise-level admin dashboards and professional user interfaces. It provides a structured project foundation and a set of React admin templates, including pre-defined layout blocks and routing configurations. The framework distinguishes itself by providing a built-in frontend mocking environment and mock-service middleware to simulate backend API responses during development. It also features integrated conversational AI components and assistant pages for embedding intelligent interactions directly into

    TypeScriptadminant-designantd
    View on GitHub↗38,401
  • apache/incubator-weexapache avatar

    apache/incubator-weex

    13,622View on GitHub↗

    Incubator-weex is a cross-platform mobile framework used to build user interfaces that run across different operating systems from a single codebase. It functions as a native UI renderer and a JavaScript native UI bridge, sending serialized UI descriptions from a JavaScript engine to native mobile components. The project includes a cross-platform UI bundler and build tool to compile source code into optimized bundles for native renderers. It also provides a UI previewer and prototyping toolset that allows for testing mobile interface pages within web browsers and on physical devices. The fra

    C++
    View on GitHub↗13,622
  • ariya/phantomjsariya avatar

    ariya/phantomjs

    29,489View on GitHub↗

    PhantomJS is a scriptable, headless browser engine based on WebKit that provides a programmatic interface for automating web page interactions. It operates without a graphical user interface, allowing for the execution of JavaScript to navigate pages, manipulate the document object model, and perform functional testing of web applications. The tool distinguishes itself by providing low-level control over the browser rendering lifecycle and network stack. It enables real-time interception and modification of network traffic, alongside the ability to generate visual snapshots and document expor

    C++automationheadlessheadless-browser
    View on GitHub↗29,489
  • astoilkov/jsblocksastoilkov avatar

    astoilkov/jsblocks

    2,750View on GitHub↗

    2012 UI framework (I was 20 years old, React didn't exist, inspired by Knockout)

    JavaScript
    View on GitHub↗2,750
  • at-ui/at-uiAT-UI avatar

    AT-UI/at-ui

    2,320View on GitHub↗

    A fresh and flat UI-Kit specially for desktop application, made with ♥ by Vue.js 2.0 (DEPRECATED)

    Vueat-uiuiuikit
    View on GitHub↗2,320
  • baconjs/bacon.jsbaconjs avatar

    baconjs/bacon.js

    6,458View on GitHub↗

    Bacon.js is a JavaScript functional reactive programming library used for coordinating complex asynchronous data flows. It functions as an observable event stream framework and an asynchronous data flow orchestrator, allowing developers to model events as declarative streams and properties. The library distinguishes itself through its ability to manage reactive state and synchronize timing across multiple sources. It provides specialized mechanisms for atomic state synchronization to prevent glitches in derived properties and offers advanced coordination strategies such as asynchronous stream

    TypeScript
    View on GitHub↗6,458
  • bendc/sprintbendc avatar

    bendc/sprint

    4,188View on GitHub↗

    Sprint is a lightweight DOM manipulation and event handling library. It provides a minimal set of utilities for selecting, modifying, and traversing elements within the browser document object model. The library utilizes a selector engine to isolate specific document nodes using CSS-like patterns and positional indices. It encapsulates raw DOM elements within a wrapper object to provide a consistent API for updating element attributes, styles, and content. The toolset covers browser event management for attaching and detaching interaction handlers, as well as document tree navigation to loca

    JavaScript
    View on GitHub↗4,188
  • ant-design/ant-designant-design avatar

    ant-design/ant-design

    98,362View on GitHub↗

    Ant Design is an enterprise-grade component library and design system framework built for developing complex, data-heavy web applications. It provides a comprehensive collection of pre-built, state-driven interface elements that map data properties to rendered components, ensuring consistent interaction patterns and visual language across large-scale projects. The library distinguishes itself through a robust styling architecture that utilizes design tokens and hierarchical configuration providers to propagate global settings like themes, locale, and layout direction. By employing component-l

    TypeScriptant-designantddesign-systems
    View on GitHub↗98,362
  • bitwalker/keys.jsB

    bitwalker/keys.js

    0View on GitHub↗
    View on GitHub↗0
  • box/t3jsbox avatar

    box/t3js

    1,541View on GitHub↗

    DEPRECATED - A minimal component-based JavaScript framework

    JavaScript
    View on GitHub↗1,541
  • bradtraversy/50projects50daysbradtraversy avatar

    bradtraversy/50projects50days

    40,577View on GitHub↗

    This project is an educational code repository containing a collection of over 50 mini web development exercises. It serves as a front-end learning resource designed to help developers practice foundational skills by building small, interactive projects using standard HTML, CSS, and JavaScript. The repository distinguishes itself by focusing on standalone interactive component prototyping and the implementation of client-side logic. Each project is organized into a decoupled directory structure, allowing users to explore individual interface patterns and visual effects in isolation. These exe

    CSS
    View on GitHub↗40,577
  • buuing/lucky-canvasbuuing avatar

    buuing/lucky-canvas

    8,728View on GitHub↗

    Lucky Canvas is a canvas-based lottery component library that enables developers to build interactive prize wheels, grid-based lottery games, and slot machines for web and mobile applications. The project provides a rendering engine that draws directly on HTML Canvas elements, with automatic device pixel ratio scaling to ensure crisp displays on high-DPI mobile screens. The library packages each lottery type as a self-contained plugin with its own configuration and rendering logic, and wraps the core canvas functionality in framework-specific bindings for Vue, React, Taro, and UniApp without

    TypeScriptcanvasjavascriptlucky-draw
    View on GitHub↗8,728
  • ccampbell/mousetrapccampbell avatar

    ccampbell/mousetrap

    11,774View on GitHub↗

    Mousetrap is a JavaScript keyboard shortcut library used to bind specific key combinations and sequences to custom functions in web applications. It serves as a keyboard event handler that listens to and manages keypress, keydown, and keyup events across a browser window. The library includes a sequence-based input manager for triggering actions based on a precise series of keys pressed in a specific order. It also provides a custom shortcut recorder to capture user keystrokes for defining and saving personalized shortcuts. The system supports global binding registration to ensure shortcuts

    JavaScriptjavascriptkeyboardkeyboard-shortcuts
    View on GitHub↗11,774
  • chanind/hanzi-writerchanind avatar

    chanind/hanzi-writer

    4,835View on GitHub↗

    Hanzi Writer is an interactive Chinese character writing tutor and SVG animation library designed to visualize and validate the sequential construction of characters. It functions as a pedagogical tool for practicing calligraphy by rendering stroke-by-stroke animations and validating user-drawn paths. The library provides a system for comparing user input against predefined stroke sequences to verify writing accuracy in real time. It guides users through interactive exercises, directing the writing process and providing immediate feedback on stroke order. The tool handles the retrieval of ch

    TypeScript
    View on GitHub↗4,835
  • chentsulin/electron-react-boilerplatechentsulin avatar

    chentsulin/electron-react-boilerplate

    24,242View on GitHub↗

    This project is a cross-platform desktop boilerplate and application template used to build software for Windows, macOS, and Linux. It provides a pre-configured foundation that combines Electron and React to accelerate the bootstrapping of desktop applications. The starter kit integrates TypeScript to maintain type safety in large-scale projects and provides a scalable structure for frontend integration within a desktop shell. The project includes a build pipeline for multi-platform software distribution, utilizing a module bundling system to optimize assets. Its architecture implements a sp

    TypeScript
    View on GitHub↗24,242
  • chokcoco/css-inspirationchokcoco avatar

    chokcoco/CSS-Inspiration

    10,866View on GitHub↗

    This project is a curated collection of galleries and component libraries that demonstrate pure CSS visual effects, 3D transforms, animation patterns, and layout solutions. It serves as a visual catalog of interactive UI elements and graphics built exclusively with HTML and CSS. The collection distinguishes itself by implementing complex interactivity, such as state management and animation triggers, using only CSS pseudo-classes and keyframes without any JavaScript. It also features a system for generative art and algorithmic patterns, as well as spatial 3D constructions using perspective an

    CSS
    View on GitHub↗10,866
  • dcloudio/uni-appdcloudio avatar

    dcloudio/uni-app

    41,549View on GitHub↗

    uni-app is a cross-platform framework for building mobile and web applications from a single Vue.js codebase. It provides a multi-platform app compiler and a cross-platform UI library to ensure consistent behavior and visual presentation across different operating systems. The project features a native API bridge and a universal plugin system that wrap native SDKs into a unified interface, allowing developers to access device hardware and operating system functions. It utilizes a specialized rendering engine and native performance compilation to bypass standard document overhead and achieve h

    Objective-Candroidcross-platformcrossplatform
    View on GitHub↗41,549
  • developit/preactdevelopit avatar

    developit/preact

    38,704View on GitHub↗

    Preact is a declarative UI library and a lightweight alternative to React for building user interfaces. It utilizes a component-based architecture and a virtual DOM to sync application state to the browser interface efficiently. The framework implements a modern React API and provides a compatibility layer to ensure existing component libraries and patterns can run within its environment. It also functions as a server-side rendering engine, generating HTML on the server and hydrating it on the client to optimize page load speeds. Additional capabilities include virtual DOM state management t

    JavaScript
    View on GitHub↗38,704
  • didi/chameleondidi avatar

    didi/chameleon

    8,966View on GitHub↗

    Chameleon is a cross-platform application framework and component library used to develop applications for the web and various mini-app platforms from a single shared codebase. It functions as a multi-platform build pipeline that compiles source code into different target formats while providing an MVVM-based user interface system for managing application state. The framework employs a polymorphic protocol to extend custom components and APIs, allowing for platform-specific implementations while maintaining cross-end compatibility. It includes a specialized build tool for static analysis that

    JavaScript
    View on GitHub↗8,966
  • didi/logicflowdidi avatar

    didi/LogicFlow

    11,441View on GitHub↗

    LogicFlow is an SVG-based flowchart editing framework and visual graph editor used for building customizable business process diagrams. It serves as a customizable diagramming engine for rendering business process models, entity relationship diagrams, and unified modeling language charts. The system is characterized by a plugin-based architecture that allows developers to define specialized graphical elements and register pluggable modules. A distinctive feature is its overlay system, which positions standard HTML components on top of the SVG canvas to create interactive menus and control pan

    TypeScriptbpmndiagramdiagramming
    View on GitHub↗11,441
  • dream-num/luckysheetdream-num avatar

    dream-num/Luckysheet

    16,644View on GitHub↗

    Luckysheet upgraded to Univer

    JavaScriptcanvaschartconditional-formatting
    View on GitHub↗16,644
  • alloyteam/alloycropAlloyTeam avatar

    AlloyTeam/AlloyCrop

    937View on GitHub↗

    The best and tiny size mobile cropping component - 做最好且最小的移动裁剪组件

    JavaScript
    View on GitHub↗937