awesome-repositories.com
Blog
MCP
awesome-repositories.com

Discover the best open-source repositories with AI-powered search.

ExploreCurated searchesOpen-source alternativesSelf-hosted softwareBlogSitemap
ProjectMCP serverAboutHow we rankPress
LegalPrivacyTerms
© 2026 Bringes Technology SRL·VAT RO45896025·hello@awesome-repositories.com
Back to willmcpo/body-scroll-lock

Projects sharing features with Body Scroll Lock

30 open-source projects similar to willmcpo/body-scroll-lock, ranked by shared indexed features. Tags may describe platforms or build tools rather than the same primary purpose. Check each project’s use case, license, and deployment requirements before treating it as a replacement.

  • umano/androidslidinguppanelumano avatar

    umano/AndroidSlidingUpPanel

    9,456View on GitHub↗

    AndroidSlidingUpPanel is an Android custom view component and sliding panel library used to create draggable overlays that slide up from the bottom of an application screen. It functions as a nested scrolling UI framework that coordinates touch events between a draggable panel and its internal scrollable content. The library distinguishes itself through a parallax effect implementation that shifts background content at different speeds than the foreground panel. It supports the definition of intermediate anchor points to create partial-view states and allows for transition physics customizati

    Java
    View on GitHub↗9,456
  • didi/cube-uididi avatar

    didi/cube-ui

    9,116View on GitHub↗

    cube-ui is a mobile-first Vue.js component library that provides a comprehensive set of pre-built UI elements for building touch-based mobile web applications. The library is built on Vue's single-file component architecture and supports on-demand ES module imports, allowing developers to selectively load only the components they need to optimize bundle size. It also offers plugin-based global registration for convenient setup and includes a CLI scaffolding tool to generate project skeletons with pre-configured build settings. The library distinguishes itself with a gesture-driven interaction

    JavaScriptcube-uijavascriptui-library
    View on GitHub↗9,116
  • chalarangelo/30-seconds-of-reactChalarangelo avatar

    Chalarangelo/30-seconds-of-react

    5,081View on GitHub↗

    This project is a comprehensive collection of reusable code snippets, custom hooks, and implementation patterns for building user interfaces with React. It serves as a library of short examples designed to solve common development tasks, ranging from state management to DOM integration. The collection provides a wide array of specialized utilities for interacting with browser APIs, including window dimension tracking, media query evaluation, and online status monitoring. It also includes practical guides and snippets for performance optimization, such as memoization, lazy loading, and state c

    JavaScripteducationjavascriptlearn-to-code
    View on GitHub↗5,081

AI search

Explore more awesome repositories

Describe what you need in plain English — the AI ranks thousands of curated open-source projects by relevance.

Find more with AI search
  • jamesblasco/modal_bottom_sheetjamesblasco avatar

    jamesblasco/modal_bottom_sheet

    1,966View on GitHub↗

    Modal bottom sheet is a cross-platform mobile UI framework plugin for Flutter that renders advanced modal bottom sheets and interactive overlay components. It provides a specialized routing mechanism for custom route-based modal presentations, layout utilities for edge-to-edge safe area inset handling, gesture interception systems for nested scroll view coordination, and navigation structures for sequential modal overlay stacking. The library supports platform-adaptive widget styling that dynamically switches between Material Design and iOS Cupertino visual guidelines based on the host platfo

    Dartcupertinodartflutter
    View on GitHub↗1,966
  • react-native-community/react-native-modalreact-native-community avatar

    react-native-community/react-native-modal

    5,656View on GitHub↗

    This project is a cross-platform UI component for React Native applications that provides a customizable overlay window for presenting content on top of existing application views. It serves as a library for managing animated modal components, backdrops, and mobile transitions. The component distinguishes itself through support for custom enter and exit animations and highly configurable backdrops, allowing for the adjustment of opacity, color, and the integration of custom elements. It also implements gesture-based dismissal, enabling users to close overlays via background taps or swipes in

    TypeScript
    View on GitHub↗5,656
  • hugeterry/coordinatortablayouthugeterry avatar

    hugeterry/CoordinatorTabLayout

    4,175View on GitHub↗

    CoordinatorTabLayout is a custom Android user interface component that integrates tabbed navigation with folding headers and paging container synchronization. Built for the native Android view system, it implements Material Design patterns to create immersive screens where header content collapses as the user scrolls. The component synchronizes tab selection events with a paging container to update visible content. It manages the coordination between a tab navigation bar and a folding header, ensuring that scrolling events and page transitions remain aligned. The layout includes capabilities

    Javaandroidandroid-librarycoordinatorlayout
    View on GitHub↗4,175
  • ikew0ng/swipebacklayoutikew0ng avatar

    ikew0ng/SwipeBackLayout

    6,089View on GitHub↗

    SwipeBackLayout is an Android gesture navigation library that provides the mechanisms for implementing native-style edge-swipe interactions and view transitions. It functions as a swipe-to-dismiss layout manager and touch event interceptor, allowing users to return to previous screens through physical touch gestures. The library manages the visual transition between screens using a coordinate-based translation system. This includes the use of alpha scaling, view-hierarchy layering, and horizontal translation to maintain visual continuity during navigation. The system includes tools for defin

    Java
    View on GitHub↗6,089
  • scwang90/smartrefreshlayoutscwang90 avatar

    scwang90/SmartRefreshLayout

    25,141View on GitHub↗

    SmartRefreshLayout is a pull-to-refresh framework and gesture interaction library for Android. It provides a scroll view wrapper that integrates interactive refresh headers and loading footers into mobile user interfaces, coordinating synchronized scrolling and touch events. The project features a pluggable architecture for custom refresh indicators and secondary refresh mechanisms. It utilizes damping-based gesture translation and overscroll rebound mechanisms to manage the tactile feel of drag resistance and physics-based animations. The library covers a broad range of interaction logic, i

    Javaandroidandroid-uifooter
    View on GitHub↗25,141
  • gcssloop/androidnoteGcsSloop avatar

    GcsSloop/AndroidNote

    9,332View on GitHub↗

    AndroidNote is a technical knowledge base and reference resource for Android development. It provides comprehensive guidance on application architecture, custom view development, and advanced graphics programming. The project is distinguished by its depth in visual implementation, covering pseudo-3D perspective projections via virtual cameras and complex 2D rendering using Bézier curves and PorterDuff color blending. It also provides detailed methodologies for app modularization and the management of internal libraries through private Maven repositories and JitPack. The reference surface ext

    Javaandroidandroid-studiocustom-view
    View on GitHub↗9,332
  • chrisbanes/android-pulltorefreshchrisbanes avatar

    chrisbanes/Android-PullToRefresh

    8,648View on GitHub↗

    Android-PullToRefresh is an Android view component and library designed to implement pull-to-refresh functionality and end-of-list detection for scrollable views within Android applications. It acts as a custom view that manages the animations and listener triggers necessary to update content via user interaction. The library provides mechanisms for triggering refresh actions when a user pulls from the boundaries of a scrollable view and detecting when a user reaches the bottom of a list to facilitate data pagination. It allows for the customization of the refresh indicator's visual theme and

    Java
    View on GitHub↗8,648
  • ftlabs/fastclickftlabs avatar

    ftlabs/fastclick

    18,534View on GitHub↗

    Fastclick is a JavaScript library and touch event optimization tool designed to remove the 300ms delay between a physical tap and a click event on mobile browsers. It functions as a lightweight DOM event handler middleware that manages touch-to-click timing to reduce input lag and improve the responsiveness of mobile web interfaces. The library provides granular control over touch latency removal, including a mechanism to exclude specific elements from this optimization. This allows certain user interface components to maintain native browser touch behavior via CSS class identifiers. The pro

    HTML
    View on GitHub↗18,534
  • ustbhuangyi/better-scrollustbhuangyi avatar

    ustbhuangyi/better-scroll

    16,489View on GitHub↗

    Better-scroll is a JavaScript scroll library and touch interaction engine designed to create high-performance scrollable areas in web browsers. It functions as a modular UI component framework that provides the foundation for building complex scrollable elements. The library is distinguished by a plugin-based architecture that allows the injection of custom methods and event hooks. This system enables the creation of specialized interface components such as carousel sliders, scrollable picker inputs, and draggable element systems. The project covers a wide range of mobile web interaction pat

    TypeScriptbetter-performanceiosiscroll
    View on GitHub↗16,489
  • scenee/floatingpanelSCENEE avatar

    SCENEE/FloatingPanel

    5,813View on GitHub↗

    FloatingPanel is a Swift UI component for iOS that provides an interactive bottom sheet and panel manager. It functions as a modal presentation controller that allows developers to display floating containers for related content and utilities alongside a main screen. The system utilizes a magnetic anchor system to snap panels to predefined vertical positions and supports the management of multiple panels within a single view. It synchronizes the position of the panel with the scrolling behavior of internal views to coordinate movement during user interaction. The project covers capabilities

    Swift
    View on GitHub↗5,813
  • mcxtzhang/swipedelmenulayoutmcxtzhang avatar

    mcxtzhang/SwipeDelMenuLayout

    3,791View on GitHub↗

    SwipeDelMenuLayout is an Android gesture interaction library that provides a swipe-to-reveal layout container. It allows developers to add slide-out action menus to list items by wrapping existing layouts in a specialized container without modifying the underlying view structure. The library includes a diagnostic performance monitor that hooks into the system display pipeline to detect frame drops and identify janky animations. It manages interaction coordination through velocity tracking and touch event interception to prevent conflicts between child menus and parent scrolling views. The co

    Javalistviewrecyclerviewsideslip-menu
    View on GitHub↗3,791
  • software-mansion/react-native-gesture-handlersoftware-mansion avatar

    software-mansion/react-native-gesture-handler

    6,755View on GitHub↗

    React Native Gesture Handler is a declarative library that exposes the platform's native touch and gesture system to React Native, enabling smooth, deterministic gesture handling on the UI thread. It manages gesture recognition through a native state machine with defined transitions between states like BEGAN, ACTIVE, END, and CANCELLED, routing touch events through platform-native gesture recognizers on both iOS and Android. The library provides a comprehensive gesture composition framework that allows developers to combine multiple gestures into race, simultaneous, or exclusive sequences, co

    TypeScriptgesturejavascriptreact-native
    View on GitHub↗6,755
  • bingoogolapple/bgarefreshlayout-androidbingoogolapple avatar

    bingoogolapple/BGARefreshLayout-Android

    4,287View on GitHub↗

    BGARefreshLayout-Android is a layout library for Android applications that implements pull-to-refresh and pull-up-to-load-more patterns. It serves as a specialized view container and list loading framework designed to manage loading indicators and status text during data fetching operations. The library distinguishes itself by supporting a customizable view hierarchy that allows for the integration of a dedicated advertisement space at the top of the layout, positioned above the scrollable content. It provides a view holder system that enables the creation of bespoke visual effects and animat

    Javarefreshlayout
    View on GitHub↗4,287
  • issacw0ng/swipebacklayoutIssacw0ng avatar

    Issacw0ng/SwipeBackLayout

    6,089View on GitHub↗

    SwipeBackLayout is an Android gesture navigation library and view component designed to implement edge-swipe gestures for navigating back to previous screens. It provides the underlying logic and layout management necessary to integrate horizontal swipe transitions into an application's screen stack. The library utilizes a custom layout manager to coordinate the simultaneous movement of foreground and background views. It maps horizontal touch offsets to the translation and opacity of view hierarchies, using interpolation to calculate visual progression based on the swipe percentage. The sys

    Java
    View on GitHub↗6,089
  • arielsalminen/responsive-nav.jsarielsalminen avatar

    arielsalminen/responsive-nav.js

    4,053View on GitHub↗

    This is a responsive navigation JavaScript library used to create mobile-friendly menus with screen size detection and touch support. It functions as an accessible navigation menu and a client-side layout switcher that transitions between mobile and desktop views without external dependencies. The project serves as a menu animation tool that enables smooth CSS transitions and height-based animations when toggling navigation overlays. It utilizes native browser APIs to manage interface states and ensure the navigation remains functional for screen readers and users without JavaScript. The lib

    JavaScript
    View on GitHub↗4,053
  • mcasimir/mobile-angular-uimcasimir avatar

    mcasimir/mobile-angular-ui

    2,846View on GitHub↗

    Mobile-angular-ui is a frontend framework designed for building touch-friendly mobile web applications using AngularJS and Bootstrap styles. It provides a toolkit for creating cross-platform interfaces with native-like gestures and responsive layouts, enabling developers to transform standard desktop web interfaces into touch-friendly mobile layouts with minimal structural adaptations. The framework includes directive-driven UI components such as sidebars, overlays, switches, and navigation bars. It supports declarative state management through generic directives that bind state transformatio

    JavaScript
    View on GitHub↗2,846
  • mango/slideoutmango avatar

    mango/slideout

    7,881View on GitHub↗

    Slideout is a touch-gesture UI component and navigation menu designed for mobile web applications. It provides a side panel that slides across the screen to reveal navigation options, utilizing CSS transitions to animate the movement of the viewport. The component manages the expanded or collapsed state of the navigation menu and includes logic to restrict gestures for specific interface elements to prevent interaction conflicts. It employs a system for executing custom logic triggered by menu state transitions and user drag gestures.

    JavaScript
    View on GitHub↗7,881
  • dolphin-wood/smooth-scrollbardolphin-wood avatar

    dolphin-wood/smooth-scrollbar

    3,357View on GitHub↗

    Smooth-scrollbar is a customizable JavaScript library that replaces native browser scrollbars and scrolling behavior on target DOM elements with inertial momentum physics. It provides consistent cross-browser scrolling interfaces, hardware-accelerated visual translations, and dynamic thumb positioning. The library supports nested scroll container management, allowing outer containers to continue scrolling automatically when inner scrollable areas reach their boundary edges. It features a modular plugin architecture that enables third-party extensions to hook into core scroll events, track upd

    TypeScriptcustom-scrollbarfrontendjavascript
    View on GitHub↗3,357
  • jeremybarbet/react-native-modalizejeremybarbet avatar

    jeremybarbet/react-native-modalize

    2,886View on GitHub↗

    React Native Modalize is a customizable bottom sheet component designed for mobile applications. It functions as a navigation and interface utility that allows users to access secondary content or settings through slide-up panels without leaving their current screen context. The library distinguishes itself by processing touch events and swipe gestures directly on the UI thread, ensuring responsive interaction across different mobile devices. It utilizes a portal-based rendering approach to position modal content above all other application elements, while its internal logic synchronizes scro

    TypeScriptcomponentmodalreact
    View on GitHub↗2,886
  • mui/base-uimui avatar

    mui/base-ui

    8,711View on GitHub↗

    Base UI is a headless component library and unstyled framework providing accessible interface primitives. It decouples behavioral logic and state management from the visual layer, allowing developers to implement complex UI patterns while maintaining total control over the final styling. The library implements WAI-ARIA design patterns to ensure all primitives support standard keyboard navigation and screen reader accessibility. It provides a suite of low-level building blocks that handle the internal mechanics of interface elements without bundling any CSS. The framework covers a broad range

    TypeScriptaccessibilitydesign-systemreact
    View on GitHub↗8,711
  • orderella/popupdialogorderella avatar

    orderella/PopupDialog

    4,026View on GitHub↗

    PopupDialog is a Swift UI component library for iOS that provides a custom modal overlay system. It serves as a flexible replacement for the standard system alert controller, allowing for the creation of stylized popups and alerts with custom layouts. The library distinguishes itself through the ability to embed arbitrary view controllers directly into the dialog body. It includes a centralized theme configuration system to maintain consistent visual styles for containers, overlays, and buttons across an entire application. The project covers a broad range of layout and behavioral controls,

    Swift
    View on GitHub↗4,026
  • roughike/bottombarroughike avatar

    roughike/BottomBar

    8,358View on GitHub↗

    BottomBar is an Android UI component that implements a Material Design bottom navigation bar. It serves as a reusable layout element for organizing top-level application destinations through a system of selectable tabs. The component features an adaptive layout system that optimizes horizontal space for tablet displays and uses density-aware adjustments for different screen dimensions. It includes a notification badge system to alert users of updates and supports conditional selection interception to prevent navigation based on application state or permissions. The library covers a broad ran

    Javaandroidbottom-navigationjava
    View on GitHub↗8,358
  • davidjbradshaw/iframe-resizerdavidjbradshaw avatar

    davidjbradshaw/iframe-resizer

    6,927View on GitHub↗

    iframe-resizer is a JavaScript tool that automatically adjusts the dimensions of an iframe to match the size of its internal content. It functions as a cross-domain communication bridge, allowing the exchange of data and the triggering of actions between a parent window and an embedded iframe across different origins. The project includes a nested iframe coordinator to synchronize dimensions between parent pages and inner frames, preventing scrollbars in complex nested structures. It also provides an accessibility utility to manage iframe titles and attributes, ensuring embedded content is co

    JavaScriptcross-domaincross-originiframe
    View on GitHub↗6,927
  • junixapp/xpopupjunixapp avatar

    junixapp/XPopup

    8,022View on GitHub↗

    XPopup is an Android popup UI framework and overlay component library used to build customizable dialogs, bottom sheets, and overlay views. It serves as a dialog engine for creating high-performance popup views and provides a toolkit for executing entrance and exit transitions. The library is distinguished by its ability to render ultra-long, high-resolution images using memory-efficient loading and drag-to-dismiss interactions. It supports displaying overlay views while an application is in the background through system overlay permissions. The framework covers anchor-based positioning for

    Javaandroidbottomsheetdialog
    View on GitHub↗8,022
  • lcodecorex/twinklingrefreshlayoutlcodecorex avatar

    lcodecorex/TwinklingRefreshLayout

    3,984View on GitHub↗

    TwinklingRefreshLayout is a pull-to-refresh layout for Android that provides a scrollable container for implementing refresh and load-more functionality. It acts as a view wrapper for components such as RecyclerView, ScrollView, and WebView to ensure consistent refreshing and loading behaviors across different scrollable views. The project distinguishes itself through an overscroll rebound component that creates an elastic bouncing animation when users scroll past layout boundaries. It includes a system for custom refresh indicators, allowing header and footer views to animate their visual st

    Java
    View on GitHub↗3,984
  • exyte/popupviewexyte avatar

    exyte/PopupView

    4,045View on GitHub↗

    PopupView is a SwiftUI popup library and modal view manager used to display toasts and floating alerts over active screens. It functions as an overlay animation framework and notification system for rendering non-intrusive UI elements within a SwiftUI user interface. The library provides tools for overlay popup rendering and notification management, allowing for the creation of custom views that appear above primary application content. It includes capabilities for popup background customization and layout configuration to manage screen positioning and padding. The system handles modal state

    Swift
    View on GitHub↗4,045
  • chakra-ui/arkchakra-ui avatar

    chakra-ui/ark

    5,004View on GitHub↗

    Ark is a headless UI component library that delivers accessible, cross-framework primitives with behavior governed by finite state machines. It provides unstyled components that encapsulate logic and accessibility — including full keyboard navigation, focus management, and WAI-ARIA support — while leaving visual styling entirely to the consumer. Components expose scoped data attributes for CSS targeting and use state machines to produce predictable, testable interactive behavior across every state transition. The library distinguishes itself through a state propagation model that distributes

    TypeScriptcomponentsdesign-systemheadless
    View on GitHub↗5,004