awesome-repositories.com
Blog
MCP
awesome-repositories.com

Discover the best open-source repositories with AI-powered search.

ExploreCurated searchesOpen-source alternativesSelf-hosted softwareBlogSitemap
ProjectMCP serverAboutHow we rankPress
LegalPrivacyTerms
© 2026 Bringes Technology SRL·VAT RO45896025·hello@awesome-repositories.com
Back to hillobar/rope

Open-source alternatives to Rope

30 open-source projects similar to hillobar/rope, ranked by how many features they have in common. Compare stars, activity and what each one does to find the best Rope alternative.

  • sensity-ai/dotsensity-ai avatar

    sensity-ai/dot

    4,529View on GitHub↗

    Dot is a deep learning face swap tool used to replace faces in live video streams, recorded media, and static images. It functions as a deepfake media processor and real-time video manipulator that applies facial transformations through neural network mapping. The system includes a virtual camera video injector that routes processed output into a system-level virtual device to simulate a physical hardware webcam. This allows generated video to be used within third-party video conferencing software. The tool supports real-time source switching via keyboard inputs to toggle between different s

    Python
    View on GitHub↗4,529
  • iperov/deepfacelabiperov avatar

    iperov/DeepFaceLab

    19,256View on GitHub↗

    DeepFaceLab is a deep learning software suite designed for face swapping and the creation of deepfake videos. It functions as a neural network image compositor that replaces human faces or entire heads in video files to produce synthetic media. The tool provides capabilities for digital facial manipulation, including the ability to modify the perceived age of people in video sequences. It uses automated pattern recognition to blend source faces onto target frames to create seamless visual composites. The system covers a broad technical surface including landmark-based face alignment, autoenc

    Python
    View on GitHub↗19,256
  • shanren7/real_time_face_recognitionshanren7 avatar

    shanren7/real_time_face_recognition

    893View on GitHub↗

    This project is a computer vision system designed for the detection and identification of human faces within live video streams. It functions as a facial analysis pipeline that processes visual data to locate facial boundaries and match individuals against a stored database of known identities. The system utilizes a multi-stage neural network framework to isolate facial regions and extract unique identity characteristics. By converting facial image data into compact numerical vectors, it performs geometric similarity calculations to verify or identify subjects as they appear in motion. The s

    Python
    View on GitHub↗893

AI search

Explore more awesome repositories

Describe what you need in plain English — the AI ranks thousands of curated open-source projects by relevance.

Find more with AI search
  • aigc-apps/sd-webui-easyphotoaigc-apps avatar

    aigc-apps/sd-webui-EasyPhoto

    5,150View on GitHub↗

    This project is a Stable Diffusion WebUI extension that provides a graphical interface for personalized portrait generation and AI photo editing. It allows users to train custom identity models from a small set of uploaded images to create consistent digital versions of specific people. The extension includes a virtual try-on system that replaces clothing in images by aligning reference garments with template bodies. It also features tools for face swapping in both static images and videos, as well as a portrait animator that transforms static images into dynamic videos using reference-guided

    Python
    View on GitHub↗5,150
  • davidsandberg/facenetdavidsandberg avatar

    davidsandberg/facenet

    14,326View on GitHub↗

    FaceNet is a facial recognition framework designed to transform facial images into high-dimensional numerical embeddings for identity verification and recognition. It provides a deep learning face embedder that maps facial features into a Euclidean space where distance corresponds to facial similarity. The system includes tools for both supervised and unsupervised identity management. It features a face identity classifier for categorizing images into known identity classes and an unsupervised clustering tool to group similar facial embeddings together without predefined labels. The framewor

    Python
    View on GitHub↗14,326
  • justadudewhohacks/face-recognition.jsjustadudewhohacks avatar

    justadudewhohacks/face-recognition.js

    1,924View on GitHub↗

    Face-recognition.js is a computer vision software development kit for Node.js that provides tools for detecting, mapping, and identifying human faces within images and video streams. It functions as a bridge to high-performance native libraries, enabling developers to perform complex facial analysis tasks directly within JavaScript and TypeScript environments. The library distinguishes itself by combining deep learning inference with geometric landmark mapping. It utilizes pre-trained neural networks to extract facial feature vectors and employs Euclidean distance calculations to determine th

    JavaScriptfaceface-detectionface-landmark
    View on GitHub↗1,924
  • rbgirshick/py-faster-rcnnrbgirshick avatar

    rbgirshick/py-faster-rcnn

    8,287View on GitHub↗

    This project is a Python implementation of the Faster R-CNN object detection framework. It serves as a convolutional neural network library and tool for locating and classifying multiple objects within images. The framework provides a pre-trained model implementation that allows for object detection inference without manual training. It supports the full lifecycle of object detection, including training detectors on visual datasets to identify and bound specific object classes. The system covers capabilities for computer vision model evaluation, neural network optimization to reduce model si

    Python
    View on GitHub↗8,287
  • iperov/deepfaceliveiperov avatar

    iperov/DeepFaceLive

    30,536View on GitHub↗

    DeepFaceLive is a desktop application designed for real-time facial replacement and animation within live video streams. By utilizing deep learning models, the software performs high-speed identity mapping and facial feature analysis to transform video content as it is captured. The engine relies on GPU-accelerated inference to execute these complex image manipulation tasks at interactive frame rates. The application distinguishes itself through a modular video processing pipeline that chains specialized tasks to maintain high throughput and low latency. It features a virtual camera streaming

    Pythondeepfakefaceswapmachine-learning
    View on GitHub↗30,536
  • nutlope/restorephotosNutlope avatar

    Nutlope/restorePhotos

    4,414View on GitHub↗

    RestorePhotos is an AI face restoration tool and deep learning image upscaler designed to remove blur and reconstruct lost details in degraded facial photographs. It functions as a face photo enhancer and a generative adversarial network image processor that transforms low-quality pixels into high-resolution facial features. The system utilizes a GPU-accelerated inference engine to run machine learning models for real-time image restoration. This hardware acceleration supports the heavy matrix multiplications and tensor-based operations required to sharpen facial images and improve visual fid

    TypeScript
    View on GitHub↗4,414
  • aliaksandrsiarohin/first-order-modelAliaksandrSiarohin avatar

    AliaksandrSiarohin/first-order-model

    15,003View on GitHub↗

    This project is a generative adversarial network designed for image animation and motion transfer. It functions as a computer vision framework that synthesizes video sequences by applying motion patterns extracted from a driving video onto a static source image. The model distinguishes itself by using a keypoint-based representation to decouple object appearance from temporal movement. By tracking structural deformations through learned latent coordinates, it performs motion retargeting and synthetic media production without requiring manual annotations or object-specific training data. The

    Jupyter Notebookdeep-learninggenerative-modelimage-animation
    View on GitHub↗15,003
  • facefusion/facefusionfacefusion avatar

    facefusion/facefusion

    28,806View on GitHub↗

    Facefusion is a modular framework designed for automated image and video manipulation, specializing in tasks such as face swapping, enhancement, and restoration. It functions as a computer vision processing pipeline that chains independent machine learning modules to perform complex transformations, including facial animation, age modification, and lip synchronization. The system is built to handle both real-time interactive feeds and large-scale batch processing tasks. The platform distinguishes itself through a highly extensible architecture that supports custom processing modules and inter

    Pythonaideep-fakedeepfake
    View on GitHub↗28,806
  • tingsongyu/pytorch-tutorial-2ndTingsongYu avatar

    TingsongYu/PyTorch-Tutorial-2nd

    4,555View on GitHub↗

    This project is a comprehensive instructional resource and course for building neural networks using PyTorch. It covers the fundamental building blocks of deep learning, including tensor manipulation, automatic differentiation, and the construction of modular neural network components. The repository serves as a technical guide for several specialized domains. It provides implementation details for computer vision tasks such as image classification, object detection, and semantic segmentation, as well as natural language processing workflows involving transformers, recurrent networks, and gen

    Jupyter Notebookcomputer-visiondeepsortdiffusion-models
    View on GitHub↗4,555
  • auduno/headtrackrauduno avatar

    auduno/headtrackr

    3,704View on GitHub↗

    Headtrackr is a JavaScript library and computer vision face tracker designed to monitor head position and orientation via a webcam. It provides a head tracking API that detects face location and spatial coordinates within a live video stream to create head-coupled perspective effects. The project functions as a tool for shifting 3D rendering perspectives in real time based on physical head movements. It utilizes WebRTC and media stream integration to capture video data and identify a user's face and rotation within a web browser. The library covers computer vision capabilities for face and h

    JavaScript
    View on GitHub↗3,704
  • datitran/object_detector_appdatitran avatar

    datitran/object_detector_app

    1,305View on GitHub↗

    This application is a real-time computer vision system designed to identify and label objects within live video feeds, recorded files, and static images. It functions as a comprehensive framework that integrates pre-trained machine learning models with video processing pipelines to perform multi-object localization and visual data tracking. The system distinguishes itself through a multithreaded architecture that decouples frame acquisition from detection logic, ensuring the interface remains responsive during continuous analysis. It provides specialized scripts for training and optimizing cu

    Pythonopencvtensorflow
    View on GitHub↗1,305
  • fudan-generative-vision/hallo2fudan-generative-vision avatar

    fudan-generative-vision/hallo2

    3,713View on GitHub↗

    Hallo2 is an AI video generation tool and audio-driven portrait animation framework designed to transform static images into speaking videos. It functions as a portrait image animator that synchronizes a single photo with an audio track to produce high-resolution talking head videos. The system includes a distributed animation trainer for fine-tuning deep learning models using custom datasets and distributed computing resources. It employs hierarchical video generation and temporal consistency modeling to produce long-form character animations that remain stable over extended durations. The

    Python
    View on GitHub↗3,713
  • lltcggie/waifu2x-caffelltcggie avatar

    lltcggie/waifu2x-caffe

    8,228View on GitHub↗

    waifu2x-caffe is a deep learning image upscaler and denoiser that uses the Caffe framework to increase image resolution and remove noise from illustrations and photographs. It functions as a neural network image processor that reduces compression artifacts and pixelation while maintaining visual clarity. The project provides specialized neural network weights optimized separately for 2D illustrations and real-world photographs. It includes distinct processing for alpha channels to preserve transparency and employs test-time augmentation to improve output precision. The tool supports both a c

    C++
    View on GitHub↗8,228
  • magicleap/supergluepretrainednetworkmagicleap avatar

    magicleap/SuperGluePretrainedNetwork

    4,035View on GitHub↗

    This project is a collection of neural network models and geometric tools designed for image feature matching, spatial alignment, and visual localization. It provides a pre-trained neural network model for identifying high-accuracy correspondences between sparse image features without requiring local training. The system utilizes a graph neural network matcher that employs attention mechanisms and message passing to learn spatial relationships between image feature points. It integrates a RANSAC camera pose estimator to filter feature matches and calculate the relative spatial transformation

    Pythondeep-learningfeature-matchinggraph-neural-networks
    View on GitHub↗4,035
  • microsoft/bringing-old-photos-back-to-lifemicrosoft avatar

    microsoft/Bringing-Old-Photos-Back-to-Life

    15,691View on GitHub↗

    This project is a deep learning image restoration tool designed to remove scratches, fading, and noise from aged photographs and film. It utilizes generative adversarial networks for image translation, alongside specialized networks for face enhancement and video colorization. The system distinguishes itself through a combination of latent-space domain mapping and progressive face enhancement to recover blurred or missing high-frequency facial details. For video content, it employs a colorization framework that uses optical flow and temporal guidance to propagate color from selected keyframes

    Pythongansgenerative-adversarial-networkimage-manipulation
    View on GitHub↗15,691
  • openshot/openshot-qtOpenShot avatar

    OpenShot/openshot-qt

    5,481View on GitHub↗

    This project is an open-source video production suite and non-linear video editor. It provides a multi-track timeline for cutting, splicing, and arranging video and audio clips with frame-level precision, serving as a comprehensive workspace for video post-production. The suite includes specialized tools for keyframe animation, allowing for the creation of 2D and 3D visual effects and motion graphics. It also features a multi-track audio mixer for blending sound sources and adjusting levels to accompany visual content. Capability areas cover a full post-production workflow, including color c

    Pythonc-plus-plusffmpeggplv3
    View on GitHub↗5,481
  • siddharthvaddem/openscreensiddharthvaddem avatar

    siddharthvaddem/openscreen

    7,282View on GitHub↗

    OpenScreen is screen recording and editing software used to capture screen video and audio with an integrated timeline for trimming, cropping, and playback adjustments. It functions as a comprehensive system for recording, annotating, and exporting audio-visual content. The project includes a dynamic zoom editor for applying manual or cursor-following zooms with adjustable depth and easing. It features a local caption generator that uses on-device transcription to create voiceover captions without uploading data to external servers. Additional specialized tools allow for the integration of we

    TypeScriptelectronopen-sourcepixijs
    View on GitHub↗7,282
  • snowkylin/tensorflow-handbooksnowkylin avatar

    snowkylin/tensorflow-handbook

    3,927View on GitHub↗

    This project is a comprehensive educational resource and tutorial handbook for building, training, and deploying machine learning models using TensorFlow 2. It serves as a structured learning guide covering core deep learning concepts, including neural network architectures, automatic differentiation, and tensor operations. The handbook provides technical guidance on optimizing execution efficiency through GPU memory management, distributed training, and model quantization. It also includes detailed manuals for constructing high-performance data pipelines and exporting models for production s

    Jupyter Notebook
    View on GitHub↗3,927
  • tencentarc/gfpganTencentARC avatar

    TencentARC/GFPGAN

    37,469View on GitHub↗

    GFPGAN is a generative face restoration model and Python-based image processing tool designed to restore low-resolution facial images. It utilizes generative adversarial networks to recover fine details and increase the clarity of degraded portraits. The system employs a generative facial prior to map degraded images to a high-quality manifold, enabling blind-face restoration without requiring knowledge of the specific degradation process. It utilizes a multi-stage workflow that includes face detection, alignment, and region-specific masking to separate facial areas from the background. Beyo

    Pythondeep-learningface-restorationgan
    View on GitHub↗37,469
  • vvo/gififyvvo avatar

    vvo/gifify

    6,322View on GitHub↗

    Gifify is a tool for converting video files into optimized animated GIFs. It functions as a video to GIF converter and optimization utility that extracts specific clips from video files and burns text or subtitle overlays directly into the frames. The project differentiates itself through specialized GIF optimization, using lossy compression, color count limiting, and custom color palette generation to reduce file sizes. It also provides precise control over the output by allowing users to adjust playback speed, reverse playback direction, and resize dimensions. The software covers a broad s

    JavaScriptffmpeggifgifify
    View on GitHub↗6,322
  • weiliu89/caffeweiliu89 avatar

    weiliu89/caffe

    4,800View on GitHub↗

    Caffe is a high-performance deep learning framework and convolutional neural network library designed for training and deploying neural networks. It functions as a GPU-accelerated machine learning engine with a core implemented in C++ to enable high-throughput tensor operations. The project utilizes a declarative configuration system where model architectures and hyperparameters are defined in external text files, separating the network design from the execution code. It includes a model serialization system to export trained weights and topologies into binary files for efficient deployment a

    C++
    View on GitHub↗4,800
  • xlite-dev/lite.ai.toolkitxlite-dev avatar

    xlite-dev/lite.ai.toolkit

    4,413View on GitHub↗

    lite.ai.toolkit is a C++ computer vision toolkit designed for edge AI deployment. It enables the execution of pre-trained models for object detection, image classification, and segmentation on resource-constrained devices. The project features a multi-backend inference engine that supports the ONNX model runtime, allowing AI models to run across different hardware targets. It includes a GPU-accelerated pipeline specifically for NVIDIA hardware to reduce latency and increase processing speed. The toolkit covers a broad range of facial analysis capabilities, including emotion detection, gender

    C++
    View on GitHub↗4,413
  • xpixelgroup/basicsrXPixelGroup avatar

    XPixelGroup/BasicSR

    8,297View on GitHub↗

    BasicSR is a PyTorch-based image restoration toolbox and framework designed for training and deploying deep learning models to upscale, denoise, and deblur images and videos. It serves as a comprehensive system for image super-resolution and video quality restoration, providing the necessary infrastructure to recover fine visual details and increase pixel density. The project distinguishes itself through specialized toolkits for facial image enhancement and high-fidelity face synthesis, as well as a dedicated video quality restoration suite that utilizes deformable convolutions and generative

    Pythonbasicsrbasicvsrdfdnet
    View on GitHub↗8,297
  • xpixelgroup/diffbirXPixelGroup avatar

    XPixelGroup/DiffBIR

    4,087View on GitHub↗

    DiffBIR is a diffusion-based image restoration framework designed for blind image reconstruction. It utilizes generative diffusion priors to recover high-quality images from sources with unknown or complex degradations without requiring explicit degradation models. The system includes specialized models for face restoration, enabling the recovery of facial landmarks, textures, and backgrounds in degraded portraits. To support high-resolution outputs on hardware with limited memory, it employs a tiled image upscaler that divides images into smaller patches during sampling. The framework cover

    Python
    View on GitHub↗4,087
  • yenchenlin/nerf-pytorchyenchenlin avatar

    yenchenlin/nerf-pytorch

    6,037View on GitHub↗

    This project is a PyTorch implementation of a Neural Radiance Field framework. It serves as a 3D scene synthesizer and differentiable volumetric renderer used to train volumetric representations of scenes by predicting color and density for 3D spatial coordinates. The system enables novel view synthesis, allowing for the generation of new images of complex 3D scenes from previously unseen perspectives. It supports 3D scene reconstruction by processing 2D images and camera poses to build a digital volumetric representation of a physical space. The framework includes capabilities for 3D model

    Python
    View on GitHub↗6,037
  • yunjey/starganyunjey avatar

    yunjey/stargan

    5,292View on GitHub↗

    StarGAN is a PyTorch image-to-image translation framework designed to synthesize visual styles and attributes across multiple domains. It implements a generative adversarial network that serves as a deep learning image translator for modifying specific visual characteristics within an image dataset. The framework uses a single unified model to handle translations between multiple image domains rather than requiring separate pairs of models. It is a research implementation that learns mappings between different image attributes without the need for paired training data. The project covers the

    Python
    View on GitHub↗5,292
  • s0md3v/roops0md3v avatar

    s0md3v/roop

    3,527View on GitHub↗

    This application is a deep learning tool designed for automated face swapping in images and videos. It utilizes generative adversarial networks to map facial features from a source image onto a target subject, maintaining the original head pose, lighting, and skin texture of the target media. The software functions as a computer vision pipeline that deconstructs video files into individual frames for sequential processing. It employs pre-trained models for landmark detection and high-dimensional feature extraction to align faces precisely. To accelerate these complex tensor operations, the en

    Pythonaiface-swap
    View on GitHub↗3,527