awesome-repositories.com
Blog
MCP
awesome-repositories.com

Discover the best open-source repositories with AI-powered search.

ExploreCurated searchesOpen-source alternativesSelf-hosted softwareBlogSitemap
ProjectMCP serverAboutHow we rankPress
LegalPrivacyTerms
© 2026 Bringes Technology SRL·VAT RO45896025·hello@awesome-repositories.com
Back to fannovel16/comfyui_controlnet_aux

Projects sharing features with Comfyui Controlnet Aux

30 open-source projects similar to fannovel16/comfyui_controlnet_aux, ranked by shared indexed features. Tags may describe platforms or build tools rather than the same primary purpose. Check each project’s use case, license, and deployment requirements before treating it as a replacement.

  • dmlc/gluon-cvdmlc avatar

    dmlc/gluon-cv

    5,922View on GitHub↗

    Gluon-CV is an MXNet computer vision library that provides a comprehensive collection of pre-implemented vision architectures and training pipelines. It serves as a deep learning research toolkit and a model zoo containing state-of-the-art pre-trained weights for image and video analysis. The project includes a specialized human pose estimation library and a model compression toolkit. These tools allow for the pruning and quantization of deep learning models to increase inference speed and facilitate deployment on constrained edge hardware. The library covers a broad range of vision capabili

    Pythonaction-recognitioncomputer-visiondeep-learning
    View on GitHub↗5,922
  • facebookresearch/sapiensfacebookresearch avatar

    facebookresearch/sapiens

    5,388View on GitHub↗

    Sapiens is a high-resolution human vision model designed for high-precision, human-centric computer vision tasks. It functions as a suite of tools for estimating human pose, depth, and surface geometry. The project utilizes a vision transformer backbone to perform multiple tasks through a shared encoder. This architecture enables the simultaneous prediction of skeletal structures, joint locations, and the distance between a camera and a human subject. The model's capabilities cover human body part segmentation to isolate anatomical regions from backgrounds and surface normal prediction to re

    Python
    View on GitHub↗5,388
  • leoxiaobin/deep-high-resolution-net.pytorchleoxiaobin avatar

    leoxiaobin/deep-high-resolution-net.pytorch

    4,479View on GitHub↗

    This project is a PyTorch implementation of a research architecture designed for high-resolution representation learning. It serves as a computer vision framework focused on precise keypoint detection, human pose estimation, and semantic image segmentation. The implementation provides specialized tools for identifying anatomical landmarks on the human body and predicting facial keypoint coordinates to analyze orientation and alignment. It utilizes a system of multi-resolution parallel streams and repeated multi-scale fusion to maintain high-resolution representations throughout the network.

    Cuda
    View on GitHub↗4,479

AI search

Explore more awesome repositories

Describe what you need in plain English — the AI ranks thousands of curated open-source projects by relevance.

Find more with AI search
  • vladmandic/sdnextvladmandic avatar

    vladmandic/sdnext

    7,139View on GitHub↗

    SD.Next is an all-in-one web interface and multi-backend inference engine for generating, editing, and processing images and videos using diffusion models. It functions as a comprehensive tool for diffusion model management and an automated image processing pipeline for bulk operations. The project is distinguished by its hardware-backend abstraction layer, which provides automatic detection and acceleration for NVIDIA CUDA, AMD ROCm, Intel OpenVINO, and DirectML. It features a headless generative API and a programmatic command interface, allowing users to trigger tasks via REST API or CLI wi

    Pythonai-artcaptiondiffusers
    View on GitHub↗7,139
  • 1adrianb/face-alignment1adrianb avatar

    1adrianb/face-alignment

    7,518View on GitHub↗

    This is a PyTorch-based computer vision library for detecting 2D and 3D facial landmark coordinates. It functions as a facial landmark detector and reconstruction tool, utilizing deep learning to identify precise geometric points on human faces from image datasets. The library allows for the selection of specific detection backends to balance accuracy and processing speed. It supports the integration of precomputed bounding box files, which enables the system to bypass the initial detection phase and proceed directly to landmark extraction. The toolkit includes capabilities for batch image p

    Python
    View on GitHub↗7,518
  • lllyasviel/controlnet-v1-1-nightlylllyasviel avatar

    lllyasviel/ControlNet-v1-1-nightly

    5,156View on GitHub↗

    This project is a neural network extension for Stable Diffusion that provides spatial control and geometric consistency for text-to-image generation. It functions as an image structure controller and conditioning tool, enabling the use of external inputs to guide the layout and geometry of generated imagery. The framework is distinguished by its ability to transform input images into structural guides through various preprocessors. These include the extraction of depth maps, normal maps, and human pose landmarks, as well as the detection of Canny edges, anime lineart, and straight architectur

    Python
    View on GitHub↗5,156
  • xorbitsai/inferencexorbitsai avatar

    xorbitsai/inference

    9,358View on GitHub↗

    This project is a platform for the deployment of open source large language and multimodal models. It provides a unified interface to serve text, image, and speech models across local or cloud hardware. The system enables distributed AI inference by orchestrating model workloads across multiple nodes and devices. It includes a unified API adapter layer to standardize inputs and outputs, as well as tools for multimodal chat and structural image generation. The platform covers a broad capability surface including request batching for throughput optimization, dynamic model loading, and integrat

    Python
    View on GitHub↗9,358
  • eutropicai/final2xEutropicAI avatar

    EutropicAI/Final2x

    7,207View on GitHub↗

    Final2x is an AI image super-resolution tool and neural network inference engine designed to increase image resolution and reconstruct missing details while reducing noise. It functions as a cross-platform image upscaler that executes consistent super-resolution logic across different operating systems. The project serves as a custom model inference engine and upscaling interface, allowing for the import and application of user-defined super-resolution weights and architectures to tailor the visual output of enlarged images. The system utilizes hardware-accelerated processing to offload comp

    TypeScriptcomputer-visioncross-platformelectron
    View on GitHub↗7,207
  • city96/comfyui-ggufcity96 avatar

    city96/ComfyUI-GGUF

    3,291View on GitHub↗

    ComfyUI-GGUF is a memory optimizer and model loader for ComfyUI that enables the execution of large transformer-based generative models using quantized weights. It provides a system for loading GGUF formatted weights within a node-based diffusion interface to reduce GPU memory consumption. The project includes a quantization tool for converting standard model checkpoints into compressed binary formats and a tensor fixer to restore missing keys and correct architectures in binary model files. These utilities ensure that compressed models remain functional during inference on hardware with limi

    Python
    View on GitHub↗3,291
  • rgthree/rgthree-comfyrgthree avatar

    rgthree/rgthree-comfy

    2,789View on GitHub↗

    rgthree-comfy is a collection of custom nodes and interface enhancements designed to automate and organize generative AI workflows within ComfyUI. It provides a specialized toolset for node-based automation, dynamic data routing, and graph management. The project distinguishes itself through a dynamic data router and workflow management tools that enable bulk muting, bypassing, and navigation of complex node graphs via bookmarks and visual labels. It also includes logic and math nodes for evaluating expressions and image processing utilities for side-by-side comparisons and precise cropping.

    JavaScriptaiartcomfyuistable-diffusion
    View on GitHub↗2,789
  • hrnet/higherhrnet-human-pose-estimationHRNet avatar

    HRNet/HigherHRNet-Human-Pose-Estimation

    1,456View on GitHub↗

    HigherHRNet is a deep learning framework designed for bottom-up human pose estimation. It functions as a computer vision keypoint detector that identifies and tracks human body joints by utilizing high-resolution feature pyramids and scale-aware representation learning. The project distinguishes itself through a bottom-up approach, which identifies individual body parts across an entire image before clustering them into distinct human skeletons. This methodology is supported by multi-resolution feature fusion, which maintains high-resolution representations throughout the network by repeatedl

    Python
    View on GitHub↗1,456
  • cubiq/comfyui_ipadapter_pluscubiq avatar

    cubiq/ComfyUI_IPAdapter_plus

    6,031View on GitHub↗

    ComfyUIIPAdapterplus is a node-based extension for ComfyUI that implements IPAdapter models to guide image generation using reference images. It functions as an image prompting tool and a Stable Diffusion image adapter, allowing reference files to serve as visual prompts for controlling style, composition, and subject identity. The project provides specialized capabilities for maintaining facial identity and high-fidelity features across generated portraits. It enables the transfer of visual characteristics and artistic styles from reference images, as well as the extraction of spatial layo

    Python
    View on GitHub↗6,031
  • open-mmlab/mmdetectionopen-mmlab avatar

    open-mmlab/mmdetection

    32,756View on GitHub↗

    This project is a modular research toolkit designed for developing, training, and evaluating deep learning models for object detection, segmentation, and video instance tracking. It provides a flexible training engine that manages complex neural network execution, including distributed training, custom lifecycle hooks, and weight optimization. The framework is built around a hierarchical configuration system that allows users to define architectures, data pipelines, and training hyperparameters through composable, inheritable files. The project distinguishes itself through its highly modular

    Pythoncascade-rcnnconvnextdetr
    View on GitHub↗32,756
  • google-research/vision_transformergoogle-research avatar

    google-research/vision_transformer

    12,584View on GitHub↗

    This project is a research library and toolkit for deep learning computer vision, focused on implementing transformer and mixer-based architectures for image classification. It processes visual data by converting images into sequences of patches, allowing standard attention mechanisms to capture global dependencies without relying on traditional convolutional operations. The framework distinguishes itself through its support for multimodal embedding analysis, which maps images and text into a shared latent vector space. This capability enables zero-shot classification and cross-modal retrieva

    Jupyter Notebook
    View on GitHub↗12,584
  • yolain/comfyui-easy-useyolain avatar

    yolain/ComfyUI-Easy-Use

    2,567View on GitHub↗

    ComfyUI-Easy-Use is a custom node suite and workflow optimizer designed to simplify Stable Diffusion generation pipelines. It provides a set of integrated tools to reduce visual clutter and streamline the process of creating images from text and existing image references. The project distinguishes itself through a pipeline manager that consolidates models, conditioning, and latents into unified data pipes, eliminating complex wiring in the node graph. It also introduces a logical operator set that enables conditional if-else branching and for-loop structures directly within the visual program

    Python
    View on GitHub↗2,567
  • roboflow/trackersroboflow avatar

    roboflow/trackers

    2,565View on GitHub↗

    This project is a multi-object tracking library and computer vision toolkit designed to maintain consistent identity IDs for objects across video frames. It provides a motion-based object tracking system that converts raw detections into stable temporal tracks, enabling the analysis of object movement and behavior over time. The toolkit distinguishes itself through advanced identity maintenance, utilizing Kalman filters for linear motion tracking and sparse optical flow for camera motion estimation. It features multi-stage object association to recover occluded objects and non-linear motion t

    Pythonbytetrackmulti-object-trackingoc-sort
    View on GitHub↗2,565
  • nunchaku-ai/nunchakununchaku-ai avatar

    nunchaku-ai/nunchaku

    3,883View on GitHub↗

    Nunchaku is a 4-bit model quantization library and diffusion model inference engine designed to run large-scale neural networks on consumer GPUs. It functions as a GPU-accelerated optimizer that reduces VRAM usage and increases inference speed through weight compression and memory management. The project utilizes low-rank weight decomposition and SVD weight quantization to compress models to four-bit precision while maintaining visual fidelity. It employs kernel-level operator fusion to minimize data movement and hardware-aware precision mapping to adjust numerical precision based on the unde

    Pythoncomfyuidiffusion-modelsflux
    View on GitHub↗3,883
  • mrforexample/comfyui-3d-packMrForExample avatar

    MrForExample/ComfyUI-3D-Pack

    3,648View on GitHub↗

    ComfyUI-3D-Pack is a suite of custom nodes for ComfyUI that enables 3D asset generation and rendering within a node-based workflow. It provides a set of tools for reconstructing textured three-dimensional meshes and volumetric scenes from single images, multi-view images, or text prompts. The system includes a Gaussian splatting generator for creating high-fidelity volumetric 3D scene representations and a multi-view image generator to produce consistent image sets for reconstruction. It also features a single image 3D mesh tool to build geometry from a single 2D source. The toolset covers 3

    Pythoncomfycomfyuimachine-learning
    View on GitHub↗3,648
  • paddlepaddle/paddlexPaddlePaddle avatar

    PaddlePaddle/PaddleX

    6,163View on GitHub↗

    PaddleX is a PaddlePaddle-based framework for building, deploying, and fine-tuning AI model pipelines, with pre-built support for computer vision, OCR, document analysis, and time series tasks. It offers a toolkit of ready-to-use pipelines for image classification, object detection, segmentation, and pose estimation, alongside an end-to-end OCR document analysis pipeline that extracts text, tables, formulas, and layout information. The platform also includes a dedicated time series forecasting pipeline for analyzing historical data to detect anomalies, classify patterns, and predict future val

    Pythonai-pipelinesclassificationdeployment
    View on GitHub↗6,163
  • bing-su/adetailerBing-su avatar

    Bing-su/adetailer

    4,763View on GitHub↗

    Adetailer is a Stable Diffusion inpainting extension and automated detail enhancer that identifies specific image regions to improve quality through targeted inpainting. It functions as an AI image masking tool that uses detection models to create precise masks for automated image editing. The system distinguishes itself by integrating structural guides, such as depth and pose, to constrain the inpainting process and maintain anatomical consistency. It also supports object-specific prompt assignment, allowing unique text instructions to be mapped to multiple detected objects within a single i

    Pythonsd-webuistable-diffusion-webuistable-diffusion-webui-plugin
    View on GitHub↗4,763
  • cocodataset/cocoapicocodataset avatar

    cocodataset/cocoapi

    6,377View on GitHub↗

    This project is a toolkit and API designed for parsing, manipulating, and visualizing image annotations for computer vision tasks. It provides a programming interface to load and organize Common Objects in Context annotations, specifically for object detection, image segmentation, and keypoint estimation. The library includes tools for converting formatted JSON files into data structures that support the analysis of pixel-level masks and skeletal markers. It enables the visual verification of ground truth accuracy by rendering bounding boxes, segmentation masks, and keypoint markers directly

    Jupyter Notebook
    View on GitHub↗6,377
  • nunchaku-ai/comfyui-nunchakununchaku-ai avatar

    nunchaku-ai/ComfyUI-nunchaku

    2,901View on GitHub↗

    ComfyUI-nunchaku is a 4-bit diffusion inference engine and a set of nodes for running low-precision quantized diffusion models within ComfyUI visual workflows. It provides a backend that reduces memory overhead and increases generation speed for transformer models. The project includes specialized tools for identity-preserving generation and an image-to-image guidance toolkit that uses depth maps and reference images. It also features a multimodal visual question answering implementation and a utility for merging multiple quantized model files into single unified files. The engine covers a b

    Pythoncomfyuidiffusionflux
    View on GitHub↗2,901
  • ux-decoder/segment-everything-everywhere-all-at-onceUX-Decoder avatar

    UX-Decoder/Segment-Everything-Everywhere-All-At-Once

    4,790View on GitHub↗

    This project is a multi-modal image segmentation framework and a text-to-mask vision model. It serves as a SAM-based visual segmenter designed to isolate distinct objects within images and video by converting natural language prompts and other inputs into pixel-level semantic masks. The system functions as a multi-modal image segmentation framework that integrates text, image, and audio signals to generate masks. It includes an interactive video object tracker that isolates and tracks visual entities across video frames using referring images or textual queries. The framework provides capabi

    Python
    View on GitHub↗4,790
  • uminosachi/sd-webui-inpaint-anythingUminosachi avatar

    Uminosachi/sd-webui-inpaint-anything

    1,290View on GitHub↗

    This project is an integrated creative interface for image manipulation that combines generative canvas expansion, object segmentation, and diffusion-based inpainting. It functions as an extension for Stable Diffusion, providing a workflow to isolate specific elements and perform targeted content modifications through prompt-guided synthesis. The tool distinguishes itself by automating the creation of precise selection masks, allowing users to identify and isolate objects by pointing to them rather than manually drawing selections. By chaining segmentation models with generative diffusion pip

    Pythonai-artanythingdiffusers
    View on GitHub↗1,290
  • facebookresearch/sam2facebookresearch avatar

    facebookresearch/sam2

    19,389View on GitHub↗

    This project is a foundation model and research toolkit designed for promptable object segmentation and temporal tracking. It provides a unified framework for isolating specific regions or objects within both static images and dynamic video sequences. The system distinguishes itself through a streaming memory architecture that maintains temporal consistency by storing and retrieving object features across frames. This mechanism allows the model to resolve occlusions and preserve object identity even when targets move out of view or change appearance. By utilizing a shared backbone for both im

    Jupyter Notebook
    View on GitHub↗19,389
  • iperov/deepfaceliveiperov avatar

    iperov/DeepFaceLive

    30,536View on GitHub↗

    DeepFaceLive is a desktop application designed for real-time facial replacement and animation within live video streams. By utilizing deep learning models, the software performs high-speed identity mapping and facial feature analysis to transform video content as it is captured. The engine relies on GPU-accelerated inference to execute these complex image manipulation tasks at interactive frame rates. The application distinguishes itself through a modular video processing pipeline that chains specialized tasks to maintain high throughput and low latency. It features a virtual camera streaming

    Pythondeepfakefaceswapmachine-learning
    View on GitHub↗30,536
  • justadudewhohacks/face-recognition.jsjustadudewhohacks avatar

    justadudewhohacks/face-recognition.js

    1,924View on GitHub↗

    Face-recognition.js is a computer vision software development kit for Node.js that provides tools for detecting, mapping, and identifying human faces within images and video streams. It functions as a bridge to high-performance native libraries, enabling developers to perform complex facial analysis tasks directly within JavaScript and TypeScript environments. The library distinguishes itself by combining deep learning inference with geometric landmark mapping. It utilizes pre-trained neural networks to extract facial feature vectors and employs Euclidean distance calculations to determine th

    JavaScriptfaceface-detectionface-landmark
    View on GitHub↗1,924
  • alexjc/neural-enhancealexjc avatar

    alexjc/neural-enhance

    11,873View on GitHub↗

    Neural Enhance is a deep learning image upscaler and restoration tool designed to increase image resolution and remove blur. It functions as a neural image restoration utility for eliminating noise and JPEG artifacts, and includes a framework for training and tuning custom neural network models against image datasets. The system utilizes a containerized environment to offload tensor calculations to GPU cores, speeding up neural network inference. It features a batch processing pipeline that queues multiple image files in sequence to maximize hardware throughput. Capabilities include domain-s

    Python
    View on GitHub↗11,873
  • kohya-ss/sd-scriptskohya-ss avatar

    kohya-ss/sd-scripts

    7,133View on GitHub↗

    sd-scripts is a suite of utilities designed for fine-tuning generative models, preprocessing datasets, and converting model weights. It provides a collection of scripts for executing Stable Diffusion training through methods such as DreamBooth, textual inversion, and full fine-tuning, alongside a framework for creating and managing Low-Rank Adaptation weights. The project features specialized capabilities for model weight conversion between different architectures and precision formats. It includes tools for merging adaptation weights into base models, extracting weights from trained models,

    Python
    View on GitHub↗7,133
  • kwai-kolors/kolorsKwai-Kolors avatar

    Kwai-Kolors/Kolors

    4,607View on GitHub↗

    Kolors is a generative model implementation for synthesizing photorealistic images from natural language descriptions and visual references. It utilizes a latent diffusion model framework to produce high-fidelity imagery, operating within a compressed latent space to improve generation efficiency and quality. The system functions as a multilingual image generator, interpreting text prompts in multiple languages to produce semantically accurate visual outputs. It includes a custom model training pipeline that uses low-rank adaptation to teach the model specific subjects or artistic styles from

    Python
    View on GitHub↗4,607