awesome-repositories.com
Blog
MCP
awesome-repositories.com

Entdecke die besten Open-Source-Repositories mit KI-gestützter Suche.

EntdeckenKuratierte SuchenOpen-Source-AlternativenSelf-hosted SoftwareBlogSitemap
ProjektMCP-ServerÜber unsRanking-MethodikPresse
RechtlichesDatenschutzAGB
© 2026 Bringes Technology SRL·VAT RO45896025·hello@awesome-repositories.com
·
Back to alvr-org/alvr

Open-source alternatives to ALVR

30 open-source projects similar to alvr-org/alvr, ranked by how many features they have in common. Compare stars, activity and what each one does to find the best ALVR alternative.

  • virtualdrivers/virtual-display-driverAvatar von VirtualDrivers

    VirtualDrivers/Virtual-Display-Driver

    8,412Auf GitHub ansehen↗

    Virtual-Display-Driver is a kernel-level driver for Windows that emulates physical monitors and audio devices. It serves as a virtual monitor emulator, headless server display emulator, and virtual audio device driver to enable extended desktop space and sound routing on systems without physical hardware connections. The project enables the simulation of monitors with custom resolutions, refresh rates, and identification profiles, including support for High Dynamic Range output. It also provides software-defined audio interfaces to simulate virtual microphones and speakers. The software cove

    C++displaydisplay-driverdisplays
    Auf GitHub ansehen↗8,412
  • dusty-nv/jetson-inferenceAvatar von dusty-nv

    dusty-nv/jetson-inference

    8,734Auf GitHub ansehen↗

    jetson-inference is a set of libraries and tools for executing optimized deep learning models on embedded GPU hardware. Its primary purpose is to enable real-time computer vision and AI inference at the edge with low latency and high throughput. The project distinguishes itself through high-performance streaming analytics and the ability to execute concurrent AI pipelines on auto-grade silicon. It provides specialized support for multi-sensor stream processing, utilizing zero-copy data transport to load camera frames directly into GPU memory. The codebase covers a broad surface of capabiliti

    C++caffecomputer-visiondeep-learning
    Auf GitHub ansehen↗8,734
  • v4l2loopback/v4l2loopbackAvatar von v4l2loopback

    v4l2loopback/v4l2loopback

    4,197Auf GitHub ansehen↗

    v4l2loopback is a Linux kernel video driver that creates virtual video devices to route video streams between applications. It functions as a software-defined video source, simulating physical hardware to provide a standard video input for applications that require a capture device. The project enables video stream routing by piping data from one process to another using the Video4Linux2 standard. It includes mechanisms for device capability masking and conditional reporting to bypass strict hardware detection requirements in external software. The driver provides tools for virtual camera si

    C
    Auf GitHub ansehen↗4,197

KI-Suche

Entdecke weitere awesome Repositories

Beschreibe in einfachen Worten, was du brauchst — die KI bewertet tausende kuratierte Open-Source-Projekte nach Relevanz.

Find more with AI search
  • android/camera-samplesAvatar von android

    android/camera-samples

    5,422Auf GitHub ansehen↗

    A collection of reference implementations and code samples for integrating Android camera hardware and software APIs. The project provides demonstrations for using both the Jetpack CameraX library and the low-level Camera2 API to implement photo and video capture features. The repository includes specialized implementations for high-performance recording, such as high-frame-rate slow motion and high-dynamic-range video. It also features examples of machine learning vision, demonstrating how to analyze live camera frames for object detection and QR code scanning. The project covers broad imag

    Kotlinkotlinsamples
    Auf GitHub ansehen↗5,422
  • lipku/livetalkingAvatar von lipku

    lipku/LiveTalking

    8,042Auf GitHub ansehen↗

    LiveTalking is an interactive talking head engine and AI avatar management platform designed to synchronize synthetic speech with facial movements. It functions as a real-time orchestrator that connects large language models and text-to-speech services to neural-rendered digital humans. The project distinguishes itself through low-latency streaming capabilities and the ability to handle real-time conversational interruptions. It supports advanced audio-visual customization, including human voice cloning and the ability to drive avatar expressions using real-time webcam data. The platform cov

    Pythonaigcdigihumandigital-human
    Auf GitHub ansehen↗8,042
  • grvydev/project-lightspeedAvatar von GRVYDEV

    GRVYDEV/Project-Lightspeed

    3,668Auf GitHub ansehen↗

    Project-Lightspeed is a low-latency video relay and WebRTC live streaming server. It functions as an OBS streaming backend that ingests media streams and converts them for real-time playback in web browsers. The system operates as a WebSocket stream orchestrator, managing connection handshakes and stream authentication to coordinate signaling between the server and the client browser. It utilizes a high-speed protocol to achieve sub-second delay between the broadcast source and the viewer. The server covers media relay capabilities, including network packet relaying and the ingestion of vide

    Rust
    Auf GitHub ansehen↗3,668
  • intel/media-driverAvatar von intel

    intel/media-driver

    1,215Auf GitHub ansehen↗

    The Intel GPU Media Driver is a hardware-accelerated driver designed to facilitate video decoding, encoding, and transcoding operations on Intel graphics processing units. It functions as a low-level abstraction layer that enables media applications to offload compute-intensive processing tasks to dedicated graphics hardware engines through a standardized software interface. The driver distinguishes itself by providing a unified hardware abstraction layer that translates high-level media requests into platform-specific instructions across diverse graphics hardware generations. It manages comp

    C
    Auf GitHub ansehen↗1,215
  • jetkvm/kvmAvatar von jetkvm

    jetkvm/kvm

    4,731Auf GitHub ansehen↗

    This project provides KVM over IP hardware and software for remote computer management. It functions as an ATX power management controller, a remote serial console server, and a virtual media emulator. A WebRTC remote access gateway is used to bypass NAT and firewalls for low-latency hardware control via a web browser. The system is distinguished by its ability to simulate physical peripherals at the hardware level, including HID device emulation for keyboard and mouse input and USB mass storage emulation for streaming ISO images. It features a UART-to-web bridge for remote serial console acc

    TypeScriptkvm
    Auf GitHub ansehen↗4,731
  • fd-/rpiplayAvatar von FD-

    FD-/RPiPlay

    5,197Auf GitHub ansehen↗

    RPiPlay is an AirPlay mirroring server and media receiver designed to bridge Apple devices to Raspberry Pi hardware. It functions as a media gateway that receives encrypted video and audio streams from iOS and macOS devices to project them onto a connected display and sound system. The project focuses on low-latency video streaming by rendering frames immediately upon arrival to bypass scheduled timestamps. It utilizes bitstream manipulation and a specialized video pipeline to reduce transmission delay between the source device and the receiver. The system provides hardware-accelerated rende

    C++
    Auf GitHub ansehen↗5,197
  • vhonowslend/streamfx-publicAvatar von Vhonowslend

    Vhonowslend/StreamFX-Public

    4,158Auf GitHub ansehen↗

    StreamFX-Public is a collection of OBS Studio plugins and software components designed for broadcast enhancement. It provides a suite of visual effects, filters, hardware-accelerated encoders, and professional video encoding tools to expand the capabilities of the host application. The project distinguishes itself through the support of professional mezzanine video codecs, including DNxHR, ProRes, and Cineform, for high-fidelity post-production editing. It also implements hardware-accelerated recording via GPU cores and AMD AMF to reduce CPU overhead during live broadcasts. The toolset cover

    C++addonamdav1
    Auf GitHub ansehen↗4,158
  • anyrtcio-community/anyrtc-rtmp-opensourceAvatar von anyrtcIO-Community

    anyrtcIO-Community/anyRTC-RTMP-OpenSource

    4,904Auf GitHub ansehen↗

    This project is an RTMP media streaming SDK and a real-time communication framework designed for pushing and playing audio and video streams. It provides tools for interactive broadcasting, low-latency voice and video calls, and a cross-platform media player compatible with Windows, iOS, and Android. The toolkit enables interactive live broadcasting with support for multi-host interactions and the ability to push streams to distribution servers via CDN. It includes a cloud recording manager for capturing live sessions and saving them as files to cloud storage, along with a system for composit

    C++androidffmpeghls
    Auf GitHub ansehen↗4,904
  • daniulive/smarterstreamingAvatar von daniulive

    daniulive/SmarterStreaming

    11,170Auf GitHub ansehen↗

    SmarterStreaming is a cross-platform SDK for hardware-accelerated audio and video capture, encoding, and streaming. It provides a complete media pipeline for low-latency RTMP and RTSP streaming, and includes an embedded lightweight RTSP server that can serve live feeds directly from the source device to local network clients without requiring a separate server. The SDK also integrates with GB28181 surveillance platforms, enabling compliant device registration and streaming for standardized video monitoring systems. The project distinguishes itself through a set of integrated capabilities for

    Javaandroid-rtmpgb28181hevc
    Auf GitHub ansehen↗11,170
  • h-m-h/weylusAvatar von H-M-H

    H-M-H/Weylus

    8,883Auf GitHub ansehen↗

    Weylus is a tablet-to-PC screen mirroring tool and remote input controller that transforms a mobile device into a digital graphic tablet emulator. It enables users to stream a computer display to a mobile device while translating touch gestures, keyboard strokes, and pen data into native computer mouse and keyboard events. The system specifically functions as a virtual secondary monitor and a digital graphic tablet emulator capable of capturing stylus pressure and tilt data for professional drawing. It supports multi-touch input mapping and allows for the configuration of a mobile device as a

    Rustandroidandroid-applicationapp
    Auf GitHub ansehen↗8,883
  • gwuhaolin/livegoAvatar von gwuhaolin

    gwuhaolin/livego

    10,179Auf GitHub ansehen↗

    livego is a live streaming server written in Go that receives live video streams and broadcasts them to viewers in real time. It functions as a multi-protocol video gateway, serving as a backend for ingesting video and redistributing it through RTMP, HLS, and HTTP-FLV protocols. The server features dynamic protocol transmuxing to convert ingested streams into different formats for device compatibility and low-latency playback. It provides secure stream access and ingestion by validating unique channel keys and using security tokens. The system includes capabilities for encrypted stream deliv

    Goflashflvgolang
    Auf GitHub ansehen↗10,179
  • browserbox/browserboxAvatar von BrowserBox

    BrowserBox/BrowserBox

    3,859Auf GitHub ansehen↗

    BrowserBox is a remote browser isolation platform that executes web sessions within containerized server environments. It utilizes a server-side browser running in Docker or LXC to isolate untrusted content from local devices, transmitting the session to clients via a low-latency secure web streamer. The system features a remote browser API for provisioning ephemeral, short-lived browsing sessions and a network tunneling gateway that uses SSH tunnels and onion services to provide anonymous or secure routing. It employs GPU-accelerated server rendering to stream live video of the browser sessi

    Shell
    Auf GitHub ansehen↗3,859
  • phoboslab/jsmpegAvatar von phoboslab

    phoboslab/jsmpeg

    6,498Auf GitHub ansehen↗

    jsmpeg is a JavaScript MPEG1 video decoder and canvas-based video renderer. It functions as a client-side media decoder that processes video frames in JavaScript, rendering them to an HTML5 canvas without relying on native browser video elements. The project provides a low-latency video player capable of receiving binary media data over WebSockets for real-time streaming. It also supports the progressive loading of static video files via Ajax to allow playback to begin before a file is fully downloaded. The system includes capabilities for playback state and event management, allowing for th

    JavaScript
    Auf GitHub ansehen↗6,498
  • ant-media/ant-media-serverAvatar von ant-media

    ant-media/Ant-Media-Server

    4,693Auf GitHub ansehen↗

    Ant-Media-Server is a server-side streaming engine designed for real-time audio and video broadcasting. It functions as a live media transcoder and WebRTC streaming server, facilitating the ingestion, processing, and delivery of media streams across multiple protocols. The platform is distinguished by its cloud-scale media infrastructure, which automates server capacity expansion to handle fluctuating volumes of concurrent viewers. It utilizes adaptive bitrate streaming to adjust video quality in real time based on network conditions and employs WebRTC and SRT to achieve ultra-low latency del

    Javaabrandroid-sdkant-media
    Auf GitHub ansehen↗4,693
  • classicoldsong/moonlight-androidAvatar von ClassicOldSong

    ClassicOldSong/moonlight-android

    3,159Auf GitHub ansehen↗

    Moonlight for Android is a remote game streaming client that receives low-latency video from a remote host computer and transmits input commands back in real time. It enables remote desktop control and the management of a host computer from a mobile device. The project supports remote VR video output via 3D side-by-side video rendering for compatible monitors or headsets. It includes display output optimizations such as portrait mode, screen rotation, and view panning. The software manages input through the mapping of physical gamepads, virtual touch buttons, and mouse modes. It handles remo

    Java
    Auf GitHub ansehen↗3,159
  • xcodesorg/xcodesappAvatar von XcodesOrg

    XcodesOrg/XcodesApp

    8,431Auf GitHub ansehen↗

    XcodesApp is a desktop application and version manager for the Xcode integrated development environment. It functions as a macOS development tool that enables the installation, updating, and switching of multiple Xcode versions. The application automates the process of downloading and deploying specific software versions and metadata. It provides a metadata browser to view available releases, release notes, and operating system compatibility requirements. The tool manages the installation of platform runtimes and SDKs for iOS, macOS, watchOS, and tvOS. It allows users to select and toggle th

    Swiftcombinehacktoberfestmacos
    Auf GitHub ansehen↗8,431
  • nvidia/isaac-gr00tAvatar von NVIDIA

    NVIDIA/Isaac-GR00T

    6,222Auf GitHub ansehen↗
    Jupyter Notebook
    Auf GitHub ansehen↗6,222
  • iperov/deepfaceliveAvatar von iperov

    iperov/DeepFaceLive

    30,536Auf GitHub ansehen↗

    DeepFaceLive is a desktop application designed for real-time facial replacement and animation within live video streams. By utilizing deep learning models, the software performs high-speed identity mapping and facial feature analysis to transform video content as it is captured. The engine relies on GPU-accelerated inference to execute these complex image manipulation tasks at interactive frame rates. The application distinguishes itself through a modular video processing pipeline that chains specialized tasks to maintain high throughput and low latency. It features a virtual camera streaming

    Pythondeepfakefaceswapmachine-learning
    Auf GitHub ansehen↗30,536
  • httpwg/http2-specAvatar von httpwg

    httpwg/http2-spec

    3,755Auf GitHub ansehen↗

    This project provides the formal network protocol standards and technical specifications for HTTP/2. It defines the requirements for binary framing structures, the HPACK compression standard for header fields, and the general behaviors necessary to ensure consistent data exchange and interoperability between network clients and servers. The specification covers the mechanisms for binary frame multiplexing and the HPACK standard to reduce network bandwidth and latency. It details the rules for session establishment, including connection preface handshaking and protocol negotiation. The projec

    Makefilehttp2ietf
    Auf GitHub ansehen↗3,755
  • arthenica/ffmpeg-kitAvatar von arthenica

    arthenica/ffmpeg-kit

    5,836Auf GitHub ansehen↗

    ffmpeg-kit is a cross-platform SDK that wraps FFmpeg and FFprobe into native libraries for Android, iOS, macOS, Linux, and tvOS, enabling applications to execute media processing commands through platform-specific APIs. It provides a concurrent command executor that runs multiple FFmpeg operations simultaneously and collects results independently via thread-safe interfaces. The project includes a build system that compiles FFmpeg native libraries from source with configurable codec and library options for each target platform, and offers eight precompiled binary packages with different sets o

    Candroidffmpegflutter
    Auf GitHub ansehen↗5,836
  • daltoniam/starscreamAvatar von daltoniam

    daltoniam/Starscream

    8,639Auf GitHub ansehen↗

    Starscream is a Swift WebSocket client library that provides a concrete implementation of the WebSocket protocol for iOS and macOS applications. It functions as an event-driven wrapper for establishing and managing bidirectional connections to send and receive text and binary frames over TCP. The library includes a secure WebSocket client capable of encrypting traffic and validating server identities. It manages the full connection lifecycle, from the initial handshake and header exchange to session termination with custom close codes. The project covers a broad range of networking capabilit

    Swift
    Auf GitHub ansehen↗8,639
  • hacs/integrationAvatar von hacs

    hacs/integration

    7,121Auf GitHub ansehen↗

    This project is a package manager for Home Assistant that enables the discovery and installation of community-made scripts, integrations, and frontend assets. It functions as a custom component manager and a GitHub-based package manager, providing a centralized community store to extend smart home functionality via remote repositories. The system distinguishes itself through a specialized catalog and indexing service that organizes third-party extensions by category and country. It includes a version-tracking update engine that monitors commit hashes, tags, and branches to manage stable and p

    Pythoncommunityhacshome-assistant
    Auf GitHub ansehen↗7,121
  • codeplea/hands-on-network-programming-with-cAvatar von codeplea

    codeplea/Hands-On-Network-Programming-with-C

    701Auf GitHub ansehen↗

    This project serves as a comprehensive tutorial and technical resource for developing network applications in the C programming language. It focuses on the practical application of the Berkeley socket interface, guiding users through the implementation of low-level network protocols and the management of data transmission across both connection-oriented and connectionless streams. The material distinguishes itself by covering the full lifecycle of network communication, from initializing system-level protocol stacks and resolving domain names to managing complex connection behaviors. It provi

    C
    Auf GitHub ansehen↗701
  • lihaoyun6/quickrecorderAvatar von lihaoyun6

    lihaoyun6/QuickRecorder

    7,969Auf GitHub ansehen↗

    QuickRecorder is a screen recording software designed for capturing desktops, application windows, and system audio. It functions as a multi-device video recorder and tutorial capture tool, synchronizing video feeds from a computer and connected mobile devices into a single stream. The system distinguishes itself through an alpha-channel video exporter that produces recordings with transparent backgrounds. It also includes a presenter overlay system that renders a floating camera feed over screen captures and a specialized tutorial toolset that provides mouse movement highlighting and a magni

    Swift
    Auf GitHub ansehen↗7,969
  • audiorouterdev/audio-routerAvatar von audiorouterdev

    audiorouterdev/audio-router

    3,694Auf GitHub ansehen↗

    Audio Router is a virtual audio routing tool used to redirect audio streams from specific software applications to chosen playback devices and hardware outputs. It functions as an application audio manager that allows for the assignment and saving of audio device preferences for individual running processes. The software includes capabilities for duplicating audio streams, enabling a single audio signal to be sent to multiple output devices simultaneously for synchronized playback. It also provides real-time audio monitoring through peak meters to visualize signal strength and audio levels ac

    C++
    Auf GitHub ansehen↗3,694
  • fxsound2/fxsound-appAvatar von fxsound2

    fxsound2/fxsound-app

    3,598Auf GitHub ansehen↗

    This project is a system audio processor and digital signal processing engine designed to enhance system-wide sound volume and clarity. It functions as a high-fidelity sound enhancer and parametric audio equalizer that shapes the sonic profile and timbre of audio across all output devices. The software utilizes a virtual audio device driver to intercept system audio streams at the kernel level, redirecting them through a processing pipeline. This allows for real-time sound processing and low-latency audio filtration to minimize the delay between sound generation and output. The system covers

    C++
    Auf GitHub ansehen↗3,598
  • freerdp/freerdpAvatar von FreeRDP

    FreeRDP/FreeRDP

    13,336Auf GitHub ansehen↗

    FreeRDP is a full software implementation of the Remote Desktop Protocol, providing both client and server capabilities for remote session management. It functions as an RDP client library and a standalone remote desktop client, enabling remote connectivity and interoperability across different operating systems. The project includes a dedicated network device redirector and an RDP gateway client to handle authentication and proxy routing. It allows developers to integrate remote desktop functionality into third-party software applications via its client library. The software covers a wide r

    Candroidcfreerdp
    Auf GitHub ansehen↗13,336