awesome-repositories.com
Blog
MCP
awesome-repositories.com

Discover the best open-source repositories with AI-powered search.

ExploreCurated searchesOpen-source alternativesSelf-hosted softwareBlogSitemap
ProjectMCP serverAboutHow we rankPress
LegalPrivacyTerms
© 2026 Bringes Technology SRL·VAT RO45896025·hello@awesome-repositories.com
Back to facefusion/facefusion

Projects sharing features with Facefusion

30 open-source projects similar to facefusion/facefusion, ranked by shared indexed features. Tags may describe platforms or build tools rather than the same primary purpose. Check each project’s use case, license, and deployment requirements before treating it as a replacement.

  • hacksider/deep-live-camhacksider avatar

    hacksider/Deep-Live-Cam

    93,878View on GitHub↗

    Deep-Live-Cam is a generative video transformation tool designed for real-time facial manipulation and cinematic enhancement. It functions as a local-first AI runtime, performing all media processing directly on the user's hardware to ensure complete data privacy without external network dependencies. By utilizing a high-performance processing pipeline, the application enables live face swapping and interactive video modifications during active streaming sessions or on pre-recorded media. The system distinguishes itself through a hardware-abstraction execution layer that dynamically routes co

    Pythonaiai-deep-fakeai-face
    View on GitHub↗93,878
  • iperov/deepfaceliveiperov avatar

    iperov/DeepFaceLive

    30,536View on GitHub↗

    DeepFaceLive is a desktop application designed for real-time facial replacement and animation within live video streams. By utilizing deep learning models, the software performs high-speed identity mapping and facial feature analysis to transform video content as it is captured. The engine relies on GPU-accelerated inference to execute these complex image manipulation tasks at interactive frame rates. The application distinguishes itself through a modular video processing pipeline that chains specialized tasks to maintain high throughput and low latency. It features a virtual camera streaming

    Pythondeepfakefaceswapmachine-learning
    View on GitHub↗30,536
  • s0md3v/roops0md3v avatar

    s0md3v/roop

    3,527View on GitHub↗

    This application is a deep learning tool designed for automated face swapping in images and videos. It utilizes generative adversarial networks to map facial features from a source image onto a target subject, maintaining the original head pose, lighting, and skin texture of the target media. The software functions as a computer vision pipeline that deconstructs video files into individual frames for sequential processing. It employs pre-trained models for landmark detection and high-dimensional feature extraction to align faces precisely. To accelerate these complex tensor operations, the en

    Pythonaiface-swap
    View on GitHub↗3,527

AI search

Explore more awesome repositories

Describe what you need in plain English — the AI ranks thousands of curated open-source projects by relevance.

Find more with AI search
  • deepfakes/faceswapdeepfakes avatar

    deepfakes/faceswap

    55,289View on GitHub↗

    Faceswap is a comprehensive framework for automated media manipulation and neural face synthesis. It provides a modular pipeline that manages the entire lifecycle of facial feature extraction, deep learning model training, and image conversion. By coordinating complex computer vision workflows, the system enables users to map facial identities between source and destination datasets while maintaining structural alignment and lighting consistency across video frames. The project distinguishes itself through a highly extensible plugin-based architecture that handles hardware-accelerated process

    Pythondeep-face-swapdeep-learningdeep-neural-networks
    View on GitHub↗55,289
  • k4yt3x/video2xk4yt3x avatar

    k4yt3x/video2x

    18,754View on GitHub↗

    Video2x is a modular processing framework designed for AI-enhanced video upscaling and frame rate conversion. It functions as a comprehensive toolset for increasing the resolution and visual clarity of media files while generating intermediate frames to improve motion smoothness. The system is built to handle intensive media transformation tasks by leveraging hardware acceleration and custom encoding pipelines. The project distinguishes itself through a plugin-based architecture that allows for the integration of custom machine learning models and specialized algorithms. It utilizes a modular

    C++anime4kframe-interpolationmachine-learning
    View on GitHub↗18,754
  • comfyanonymous/comfyuicomfyanonymous avatar

    comfyanonymous/ComfyUI

    117,322View on GitHub↗

    ComfyUI is a modular generative AI workflow orchestrator and node-based GUI for designing and executing complex diffusion model pipelines. It functions as both a visual interface for building generative logic graphs and a programmable backend API that exposes diffusion model operations for external integration. The system distinguishes itself through a graph-based execution model that supports differential workflow execution, re-running only modified nodes to reduce computation. It features dynamic model offloading to manage memory between system RAM and GPU VRAM and utilizes metadata-embedde

    Python
    View on GitHub↗117,322
  • yuyuyzl/easyvtuberyuyuyzl avatar

    yuyuyzl/EasyVtuber

    2,690View on GitHub↗

    EasyVtuber is 2D avatar animation software that transforms a single static image into a real-time animated character. It functions as a face tracking animation tool and live streaming avatar driver, mapping facial movements from webcams or iOS devices to drive virtual expressions and head motion. The project distinguishes itself through a neural animation pipeline that includes AI video upscaling and frame interpolation to increase visual smoothness and resolution. It utilizes a transparent video streaming system via Spout2, allowing rendered frames with alpha channels to be sent directly to

    Python
    View on GitHub↗2,690
  • iree-org/ireeiree-org avatar

    iree-org/iree

    3,819View on GitHub↗

    IREE is an MLIR-based compiler toolchain and runtime designed to translate machine learning models from various frameworks into optimized binaries for execution across diverse hardware targets. It provides a unified pipeline to ingest models from PyTorch, TensorFlow, JAX, and ONNX, lowering them into a common intermediate representation for deployment on CPUs, GPUs, and bare-metal embedded systems. The project distinguishes itself through a bytecode virtual machine and a hardware abstraction layer that decouple high-level model logic from specific hardware instruction sets. It supports sophis

    C++compilercudajax
    View on GitHub↗3,819
  • aaronfeng753/waifu2x-extension-guiAaronFeng753 avatar

    AaronFeng753/Waifu2x-Extension-GUI

    16,146View on GitHub↗

    Waifu2x-Extension-GUI is a desktop application designed for high-fidelity media restoration and enhancement. It functions as a graphical interface that orchestrates specialized deep learning engines to upscale, denoise, and interpolate images and videos, improving visual clarity and motion smoothness. The software distinguishes itself through its ability to manage complex, automated media processing pipelines. Users can chain multiple tasks—such as format conversion, scene detection, and frame rate interpolation—into sequential workflows that execute without manual intervention. It provides g

    C++animeanime4kesrgan
    View on GitHub↗16,146
  • tntwise/real-video-enhancerTNTwise avatar

    TNTwise/REAL-Video-Enhancer

    2,137View on GitHub↗

    Real-Video-Enhancer is a cross-platform desktop application that utilizes neural networks to upscale resolution, generate intermediate frames, and denoise video files. It functions as a deep learning video processor that runs restoration models through hardware acceleration, dispatching heavy prediction workloads directly to underlying graphics hardware. The software executes optical-flow-based frame interpolation to increase framerates and motion smoothness, alongside dedicated filtering models that remove digital noise and blocky compression artifacts from compressed video streams. Additio

    Pythonguiinterpolationlinux
    View on GitHub↗2,137
  • sharpai/deepcameraSharpAI avatar

    SharpAI/DeepCamera

    2,858View on GitHub↗

    DeepCamera is an open-source AI video surveillance and network video recorder platform powered by local vision language models and hardware-accelerated processing. It integrates live feeds from network cameras, webcams, and mobile devices to monitor physical spaces while running local edge vision inference without relying on cloud servers. The platform incorporates privacy-preserving video anonymization that converts raw video frames into abstract depth maps in real time, retaining motion tracking while protecting personal identity. Its modular architecture supports pluggable AI scripts and

    JavaScriptaiai-cameraai-nvr
    View on GitHub↗2,858
  • djdefrag/qualityscalerDjdefrag avatar

    Djdefrag/QualityScaler

    2,970View on GitHub↗

    QualityScaler is an AI video upscaler and local media processing tool designed to increase the resolution and visual quality of videos and images. It uses deep learning models to enhance detail and remove noise, operating as an offline application that executes all computations on local hardware. The project functions as a GPU-accelerated media processor that distributes workloads across multiple graphics cards to increase rendering speed. To prevent memory overflow during high-resolution tasks, it employs a tiled image processing method that splits large assets into smaller sections. The sy

    Pythonamdanimecompression-artifact-reduction
    View on GitHub↗2,970
  • eutropicai/final2xEutropicAI avatar

    EutropicAI/Final2x

    7,207View on GitHub↗

    Final2x is an AI image super-resolution tool and neural network inference engine designed to increase image resolution and reconstruct missing details while reducing noise. It functions as a cross-platform image upscaler that executes consistent super-resolution logic across different operating systems. The project serves as a custom model inference engine and upscaling interface, allowing for the import and application of user-defined super-resolution weights and architectures to tailor the visual output of enlarged images. The system utilizes hardware-accelerated processing to offload comp

    TypeScriptcomputer-visioncross-platformelectron
    View on GitHub↗7,207
  • 1adrianb/face-alignment1adrianb avatar

    1adrianb/face-alignment

    7,518View on GitHub↗

    This is a PyTorch-based computer vision library for detecting 2D and 3D facial landmark coordinates. It functions as a facial landmark detector and reconstruction tool, utilizing deep learning to identify precise geometric points on human faces from image datasets. The library allows for the selection of specific detection backends to balance accuracy and processing speed. It supports the integration of precomputed bounding box files, which enables the system to bypass the initial detection phase and proceed directly to landmark extraction. The toolkit includes capabilities for batch image p

    Python
    View on GitHub↗7,518
  • liuzhao1225/youdub-webuiliuzhao1225 avatar

    liuzhao1225/YouDub-webui

    3,957View on GitHub↗

    YouDub-webui is a multilingual video translator and AI dubbing pipeline manager featuring a web interface for automating video translation, audio dubbing, and subtitle burning. It utilizes a GPU-accelerated media processor to speed up audio transcription and video rendering tasks. The system implements a stage-based pipeline that converts original speech into new languages while preserving background audio through audio track mixing. It supports multiple localization workflows, including automated translation and subtitle-driven dubbing using SRT files to bypass automatic transcription phases

    Python
    View on GitHub↗3,957
  • dmlc/mxnetdmlc avatar

    dmlc/mxnet

    20,812View on GitHub↗

    MXNet is a deep learning framework and distributed machine learning engine designed for training and deploying neural networks. It functions as a hardware-agnostic backend that allows for the development of deep learning models through a hybrid of symbolic and imperative programming. The system distinguishes itself through automatic distributed parallelism, which scales training workloads across multiple GPUs and machines. It features an extensible hardware backend interface that enables the integration of custom accelerators and proprietary libraries without modifying the core source code.

    C++
    View on GitHub↗20,812
  • taskforcesh/bullmqtaskforcesh avatar

    taskforcesh/bullmq

    8,432View on GitHub↗

    BullMQ is a Redis-backed message queue library and background processor designed for distributed task queueing. It functions as a distributed queue manager and task scheduler, utilizing Redis to manage asynchronous job processing and persistence. The system distinguishes itself through its role as a job workflow orchestrator, enabling the definition of complex parent-child job dependencies and hierarchies for multi-step workflows. It provides sandboxed process execution to isolate heavy workloads and prevent event loop blocking, alongside distributed rate limiting to protect downstream servic

    TypeScriptbackground-jobselixirnodejs
    View on GitHub↗8,432
  • baiyuetribe/paper2guiBaiyuetribe avatar

    Baiyuetribe/paper2gui

    10,729View on GitHub↗

    Paper2gui is a multi-modal AI toolkit and model GUI wrapper designed to deploy and run various artificial intelligence models through a visual interface. Its primary purpose is to provide a way to execute complex AI research papers and models without requiring manual software installation or coding. The project distinguishes itself by using a wrapper-based model interface that abstracts command line arguments into visual input fields, utilizing template-driven UI generation to create parameter sliders and forms based on the specific requirements of the underlying model. It includes a centrali

    Jupyter Notebook
    View on GitHub↗10,729
  • sanster/iopaintSanster avatar

    Sanster/IOPaint

    23,244View on GitHub↗

    IOPaint is an AI image editor and Stable Diffusion inpainting tool providing a web interface for removing objects and replacing image content. It utilizes latent diffusion image processing to synthesize high-resolution replacements for erased sections of an image. The project features a specialized AI background remover for isolating subjects and an AI image upscaler that employs super-resolution models for general photos and anime artwork. The software covers a broad range of capabilities including image segmentation for object isolation, face restoration for improving facial details, and t

    Pythoninpaintinglamalatent-diffusion
    View on GitHub↗23,244
  • intel/media-driverintel avatar

    intel/media-driver

    1,215View on GitHub↗

    The Intel GPU Media Driver is a hardware-accelerated driver designed to facilitate video decoding, encoding, and transcoding operations on Intel graphics processing units. It functions as a low-level abstraction layer that enables media applications to offload compute-intensive processing tasks to dedicated graphics hardware engines through a standardized software interface. The driver distinguishes itself by providing a unified hardware abstraction layer that translates high-level media requests into platform-specific instructions across diverse graphics hardware generations. It manages comp

    C
    View on GitHub↗1,215
  • onnx/onnxonnx avatar

    onnx/onnx

    20,358View on GitHub↗

    ONNX is an open-source standard for machine learning interoperability that provides a unified format for representing neural network models. By defining a common set of operators and a standardized file structure, it enables models to be shared, exported, and executed consistently across different training frameworks and software ecosystems. The project functions as an intermediate representation layer that decouples model development from deployment. It utilizes a language-neutral binary serialization format to store model structures and weights, ensuring that computational graphs remain por

    Pythonaiartificial-intelligencedeep-learning
    View on GitHub↗20,358
  • alexjc/neural-enhancealexjc avatar

    alexjc/neural-enhance

    11,873View on GitHub↗

    Neural Enhance is a deep learning image upscaler and restoration tool designed to increase image resolution and remove blur. It functions as a neural image restoration utility for eliminating noise and JPEG artifacts, and includes a framework for training and tuning custom neural network models against image datasets. The system utilizes a containerized environment to offload tensor calculations to GPU cores, speeding up neural network inference. It features a batch processing pipeline that queues multiple image files in sequence to maximize hardware throughput. Capabilities include domain-s

    Python
    View on GitHub↗11,873
  • google/jaxgoogle avatar

    google/jax

    35,835View on GitHub↗

    JAX is a hardware-accelerated array library and automatic differentiation system for numerical computing. It provides a framework compatible with NumPy that extends array operations with a just-in-time compiler to transform Python functions into optimized kernels for execution on GPU and TPU accelerators. The system differentiates itself through the use of an XLA-based compiler and a single program multiple data sharding model. These capabilities allow the library to distribute large-scale computations across multiple hardware accelerators using both automatic parallelization and manual shard

    Python
    View on GitHub↗35,835
  • soniqo/speech-swiftsoniqo avatar

    soniqo/speech-swift

    896View on GitHub↗

    This project is a comprehensive toolkit for on-device speech recognition, synthesis, and audio processing, specifically engineered for Apple Silicon. It provides a framework for building real-time, full-duplex voice agents that operate entirely offline, leveraging native hardware acceleration to maintain performance and privacy. By utilizing optimized machine learning models, the library enables local execution of complex audio tasks without reliance on external cloud services. The library distinguishes itself through its specialized focus on local, high-performance voice interaction. It incl

    Swiftapple-siliconasrcoreml
    View on GitHub↗896
  • sidekiq/sidekiqsidekiq avatar

    sidekiq/sidekiq

    13,540View on GitHub↗

    Sidekiq is a background job processor and queue manager for Ruby that uses Redis to manage asynchronous tasks. It functions as a distributed task scheduler capable of handling periodic, delayed, and recurring jobs across a cluster of worker processes. The project features a job monitoring dashboard and administrative web interface for visualizing system state, tracking worker performance, and managing failed or dead jobs. It provides a distributed rate limiter to control execution frequency across multiple processes. The framework covers a broad range of operational capabilities, including j

    Rubybackground-jobsjobsruby
    View on GitHub↗13,540
  • hkuds/deeptutorHKUDS avatar

    HKUDS/DeepTutor

    10,365View on GitHub↗

    DeepTutor is a framework for personalized AI tutoring and educational content generation. It functions as an agentic workflow system that executes reasoning loops to complete multi-step tasks, transforming raw sources into structured learning materials such as interactive books, quizzes, and concept graphs. The platform distinguishes itself through an extensible skill architecture that allows the installation and auditing of third-party capability packages from community registries. It utilizes persona-driven tool policies to deploy persistent AI companions with unique behavioral profiles and

    Pythonai-agentsai-tutordeepresearch
    View on GitHub↗10,365
  • upscayl/upscaylupscayl avatar

    upscayl/upscayl

    46,101View on GitHub↗

    Upscayl is a cross-platform desktop application designed to increase the resolution and visual quality of digital images using artificial intelligence. By executing all processing tasks locally on the user's machine, the software ensures that sensitive media files remain private and never leave the host system for cloud-based services. The application distinguishes itself through a hardware-agnostic architecture that offloads intensive rendering workloads directly to the local graphics unit. It utilizes a hardware abstraction layer to translate enhancement commands into instructions compatibl

    TypeScriptaielectronesrgan
    View on GitHub↗46,101
  • vladmandic/sdnextvladmandic avatar

    vladmandic/sdnext

    7,139View on GitHub↗

    SD.Next is an all-in-one web interface and multi-backend inference engine for generating, editing, and processing images and videos using diffusion models. It functions as a comprehensive tool for diffusion model management and an automated image processing pipeline for bulk operations. The project is distinguished by its hardware-backend abstraction layer, which provides automatic detection and acceleration for NVIDIA CUDA, AMD ROCm, Intel OpenVINO, and DirectML. It features a headless generative API and a programmatic command interface, allowing users to trigger tasks via REST API or CLI wi

    Pythonai-artcaptiondiffusers
    View on GitHub↗7,139
  • klingairesearch/liveportraitKlingAIResearch avatar

    KlingAIResearch/LivePortrait

    17,830View on GitHub↗

    LivePortrait is a computer vision framework designed for portrait animation and generative video synthesis. It functions as a deep learning system that transfers facial expressions and head movements from a driving video source onto a static image or an existing portrait video, effectively decoupling the subject's identity from the dynamic motion patterns. The framework utilizes keypoint-based motion retargeting and implicit 3D latent representations to map movements across different subjects, including both human and animal portraits. By employing canonical motion normalization and feature-s

    Pythonface-animationimage-animationvideo-editing
    View on GitHub↗17,830
  • openai/whisperopenai avatar

    openai/whisper

    102,828View on GitHub↗

    This project is a speech recognition and translation engine that utilizes a sequence-to-sequence transformer architecture to convert audio into text. It is built upon a weakly supervised learning framework, which leverages large-scale, unlabelled audio-transcript data to create generalized speech representations capable of performing simultaneous transcription, language identification, and translation. The system distinguishes itself through a unified multi-task modeling approach that shares token sequences across different objectives, allowing it to handle diverse languages and vocabularies

    Python
    View on GitHub↗102,828